(data stored in ACNUC30630 zone)

EMBL: CP002010.PE424

CP002010.PE424       Location/Qualifiers
FT   CDS             541435..542520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0447"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99923"
FT                   /db_xref="GOA:D6ZSR8"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR8"
FT                   /protein_id="ADG99923.1"
FT                   /translation="MQMRHGECKTVGGKLVAVTVSVDDDGTAQSCHISGDFFIESVSDA
FT                   ESHALLRDLEQALISDDSLRSVLDAHPSCQIIGTDEVAIKTAYSRAVSSNLPPLVGAPA
FT                   QRVGVVSPDAPNTPASINTQTKQPDKSSEYRERWNALRPQLTVIHDHPRTPDEQMAIDE
FT                   TWAREVAAGTRQPTIRFWEWAGPAVVIGRFQSAQDEVNLDIAEQLGFDVVRRCTGGGAM
FT                   FIEPGNTITYSLYAPLDFVQGVSIEESYRLCDWWLVEALRELGLDVRFAGLNDIASQYG
FT                   KIGGAAQRRFPVGSGGAVLHHVTMAYDIDAAKMSRVLNTSREKMSDKAVKSAVKRVDPM
FT                   KSQTGLSREHIVEHLIDWFAA"
     MQMRHGECKT VGGKLVAVTV SVDDDGTAQS CHISGDFFIE SVSDAESHAL LRDLEQALIS        60
     DDSLRSVLDA HPSCQIIGTD EVAIKTAYSR AVSSNLPPLV GAPAQRVGVV SPDAPNTPAS       120
     INTQTKQPDK SSEYRERWNA LRPQLTVIHD HPRTPDEQMA IDETWAREVA AGTRQPTIRF       180
     WEWAGPAVVI GRFQSAQDEV NLDIAEQLGF DVVRRCTGGG AMFIEPGNTI TYSLYAPLDF       240
     VQGVSIEESY RLCDWWLVEA LRELGLDVRF AGLNDIASQY GKIGGAAQRR FPVGSGGAVL       300
     HHVTMAYDID AAKMSRVLNT SREKMSDKAV KSAVKRVDPM KSQTGLSREH IVEHLIDWFA       360
     A                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page