(data stored in ACNUC30630 zone)

EMBL: CP002010.PE434

CP002010.PE434       Location/Qualifiers
FT   CDS             555787..556722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0457"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99933"
FT                   /db_xref="GOA:D6ZSS8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS8"
FT                   /protein_id="ADG99933.1"
FT                   /translation="MSATIEAVTQNKNDIPWNKHVRQKQKPGDWAVSGIINVLLLLTIV
FT                   AVLYPLWFVVIASFSNPNAVAGGEVLLLPKGVTFAGYAKVFANQRIWQGYLNTIIYSVV
FT                   GTAVNMAVTIPCAFALSRREFKPRRVIMFLFTVTMFIAGGLIPNYLLYKSLGINNSMWV
FT                   FILPGAVSVYNVIVARSFFETSIPEELFDAAQIDGLSYFGYFFKIVLPLSSAILAVIGL
FT                   YYFVGHWNDFMTGLIYITDDTKQPLQVVLQQLLLVAQGTGTNVNAAAQQQAADQIKFGI
FT                   IIVSTLPLLVLYPFLQKYFNKGVMLGAVKG"
     MSATIEAVTQ NKNDIPWNKH VRQKQKPGDW AVSGIINVLL LLTIVAVLYP LWFVVIASFS        60
     NPNAVAGGEV LLLPKGVTFA GYAKVFANQR IWQGYLNTII YSVVGTAVNM AVTIPCAFAL       120
     SRREFKPRRV IMFLFTVTMF IAGGLIPNYL LYKSLGINNS MWVFILPGAV SVYNVIVARS       180
     FFETSIPEEL FDAAQIDGLS YFGYFFKIVL PLSSAILAVI GLYYFVGHWN DFMTGLIYIT       240
     DDTKQPLQVV LQQLLLVAQG TGTNVNAAAQ QQAADQIKFG IIIVSTLPLL VLYPFLQKYF       300
     NKGVMLGAVK G                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page