(data stored in ACNUC30630 zone)

EMBL: CP002010.PE437

CP002010.PE437       Location/Qualifiers
FT   CDS             558678..560588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0460"
FT                   /product="Glycosyl hydrolase family 32, N terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99936"
FT                   /db_xref="GOA:D6ZST1"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST1"
FT                   /protein_id="ADG99936.1"
FT                   /translation="MPDNYSVAIETGGYRLLELFAERCGDDAAVTITDGDGHQIASHAM
FT                   PVAERRHRFLIPVPTNVCLTVRARQLTVRFAYLSECENLLDEGVRFISMNPYDNEWDTQ
FT                   PTLDQIYDRFARPAAHFEPFARWMNDPNGLCRFQGRYHLFYQFNPYGFGWDNMHWGHAV
FT                   SRDLVHWTHLPIFLEPQPELHIDERIVGGAFSGSAVTVDACDNPCKGDDAAAIRLYLTR
FT                   HLETRGDESSVTEYQTTCLCEDGVHVSVESPVALRVNDGFGFDFRDPKVETGMGGEAID
FT                   PERAYMVTATNLPVAEFDTDAVSSAAPGISVQGTDGWFTCGPQGMPGTDKPNMDTVPAM
FT                   ALFSAKKPLKRNVTWQYEGPVLADFGHQLSRTYECPDLFQLDGKTVAIGALMHYRDKQG
FT                   RFQQVRWYVGDLKDTADGPRLQVGNSDWCDFGTGYYATQSFAADDGRRIVFGWYTDFPA
FT                   MRVEKPCIANGMMSLPRELHVRDGRLTSRPVKEVYEQLLGDRLEAHADENGTFFIVPNN
FT                   AYYTDMHLADDDDFTMLIATGTNSANGNSMELQLQRRDGVTRLVTKGTVVDDIDFDSGI
FT                   ADVRRVEIFFDRNVVEVFLNNGEAAGSMLFQGADGDGEFRFVADGKVDCVDVRVLDGIW
FT                   R"
     MPDNYSVAIE TGGYRLLELF AERCGDDAAV TITDGDGHQI ASHAMPVAER RHRFLIPVPT        60
     NVCLTVRARQ LTVRFAYLSE CENLLDEGVR FISMNPYDNE WDTQPTLDQI YDRFARPAAH       120
     FEPFARWMND PNGLCRFQGR YHLFYQFNPY GFGWDNMHWG HAVSRDLVHW THLPIFLEPQ       180
     PELHIDERIV GGAFSGSAVT VDACDNPCKG DDAAAIRLYL TRHLETRGDE SSVTEYQTTC       240
     LCEDGVHVSV ESPVALRVND GFGFDFRDPK VETGMGGEAI DPERAYMVTA TNLPVAEFDT       300
     DAVSSAAPGI SVQGTDGWFT CGPQGMPGTD KPNMDTVPAM ALFSAKKPLK RNVTWQYEGP       360
     VLADFGHQLS RTYECPDLFQ LDGKTVAIGA LMHYRDKQGR FQQVRWYVGD LKDTADGPRL       420
     QVGNSDWCDF GTGYYATQSF AADDGRRIVF GWYTDFPAMR VEKPCIANGM MSLPRELHVR       480
     DGRLTSRPVK EVYEQLLGDR LEAHADENGT FFIVPNNAYY TDMHLADDDD FTMLIATGTN       540
     SANGNSMELQ LQRRDGVTRL VTKGTVVDDI DFDSGIADVR RVEIFFDRNV VEVFLNNGEA       600
     AGSMLFQGAD GDGEFRFVAD GKVDCVDVRV LDGIWR                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page