(data stored in ACNUC30630 zone)

EMBL: CP002010.PE439

CP002010.PE439       Location/Qualifiers
FT   CDS             561165..562529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0462"
FT                   /product="protein of unknown function DUF711"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99938"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST3"
FT                   /protein_id="ADG99938.1"
FT                   /translation="MLNIMEVHETNQMIEQEKLDVRTITMGISLLDCASDDVDKTCDNI
FT                   YRKITTYAKDLVSTGKAIERDYGIPIVNKRITVTPISLVGASSCKTSEDFVKIAHALDK
FT                   AAKEVGVDLIGGYSALVSKSMTPAEELLIRSLPQALSETDIVCSSVNVGSTKTGIDMNA
FT                   VELLGHIIKDVAERTADNDSYGCVKFVAFCNVPDDNPFMAGGFHGVTEGDAVINVGVSG
FT                   PGVVSRALDAAKGKDFEFLCETIKRTAFKITRVGQLVAQEASRRLGIPFGIIDLSLAPT
FT                   PAVGDSVGEVLEKIGLEQVGAPGTTAALAMLNDQVKKGGIMASSYVGGLSGAFIPVSED
FT                   KNMIDAASSGCLTIEKLEAMTCVCSVGLDMIAIPGDTTAATISGIIADEAAIGMVNQKT
FT                   TAVRVIPVEGKGVGEMANFGGLMGYAPIIPVNQTSCEAFVTRGGRIPAPIHSFKN"
     MLNIMEVHET NQMIEQEKLD VRTITMGISL LDCASDDVDK TCDNIYRKIT TYAKDLVSTG        60
     KAIERDYGIP IVNKRITVTP ISLVGASSCK TSEDFVKIAH ALDKAAKEVG VDLIGGYSAL       120
     VSKSMTPAEE LLIRSLPQAL SETDIVCSSV NVGSTKTGID MNAVELLGHI IKDVAERTAD       180
     NDSYGCVKFV AFCNVPDDNP FMAGGFHGVT EGDAVINVGV SGPGVVSRAL DAAKGKDFEF       240
     LCETIKRTAF KITRVGQLVA QEASRRLGIP FGIIDLSLAP TPAVGDSVGE VLEKIGLEQV       300
     GAPGTTAALA MLNDQVKKGG IMASSYVGGL SGAFIPVSED KNMIDAASSG CLTIEKLEAM       360
     TCVCSVGLDM IAIPGDTTAA TISGIIADEA AIGMVNQKTT AVRVIPVEGK GVGEMANFGG       420
     LMGYAPIIPV NQTSCEAFVT RGGRIPAPIH SFKN                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page