(data stored in ACNUC30630 zone)

EMBL: CP002010.PE446

CP002010.PE446       Location/Qualifiers
FT   CDS             574582..575634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99945"
FT                   /db_xref="GOA:D6ZSU0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU0"
FT                   /protein_id="ADG99945.1"
FT                   /translation="MSKHSRNDGRQPEQYARLSESPSEDESDEEFRQFLLAKGDQNDPA
FT                   VRDMLKTIDRDRYERSAANGGPTLEYESHGLFALTVPHLHGPRPGRRAFGMRGVVLKSL
FT                   WFLFVFVVSVVVQVVFMDAAKANGSGDWWPLAAVPNVVVFALVFTSMALSPFLMLLFGG
FT                   IWPRLWGLSILFGSLAMLAVGSFVGQEVGRRWLWDRYVATGLLKPGDFVDWSSDRLPAP
FT                   LAQPASGGWWVTGLVAGVLLVSGSLFLYREDRHRGSNILPRYISYGGGVVGLVAAIGIA
FT                   LTRHVSGFALVAAPFIALFVGLLWFPLDLAAACFCVDNRRESCGEWPAAFWLTAEALFV
FT                   IGVCTALPMA"
     MSKHSRNDGR QPEQYARLSE SPSEDESDEE FRQFLLAKGD QNDPAVRDML KTIDRDRYER        60
     SAANGGPTLE YESHGLFALT VPHLHGPRPG RRAFGMRGVV LKSLWFLFVF VVSVVVQVVF       120
     MDAAKANGSG DWWPLAAVPN VVVFALVFTS MALSPFLMLL FGGIWPRLWG LSILFGSLAM       180
     LAVGSFVGQE VGRRWLWDRY VATGLLKPGD FVDWSSDRLP APLAQPASGG WWVTGLVAGV       240
     LLVSGSLFLY REDRHRGSNI LPRYISYGGG VVGLVAAIGI ALTRHVSGFA LVAAPFIALF       300
     VGLLWFPLDL AAACFCVDNR RESCGEWPAA FWLTAEALFV IGVCTALPMA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page