(data stored in ACNUC30630 zone)

EMBL: CP002010.PE447

CP002010.PE447       Location/Qualifiers
FT   CDS             575682..576911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99946"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU1"
FT                   /protein_id="ADG99946.1"
FT                   /translation="MSIRLDERRYVEELKRLVADFRMWKNPLVPLPDGFEDDLAWRSYR
FT                   VFGQTSPADIIALAVRTRDEDLVAQGEGFISDSVSMIDDEDVFGWLFRMIWGKELQLRQ
FT                   QIADADVENLDATFDFLTSACRLAAHVLLGWGEGDTSSAYIARLFLIEQYDDALNCILP
FT                   YSNVSLNTNESELVVSDLRDRAIAAAMRRGETAAMEMKLHKAEDGPHYSSGEDSTASDD
FT                   GEGLDVADDGRPFPQSDVLYLFDADHVIEAYRYFLDHADGDADGDGELDNGNPWRRPDF
FT                   VQDKLLTLAGAGIVEPLVSTALEQGDGDRLEAALNLLTIYRGIVCDDGILALPIIAART
FT                   LQDSDGLRPDADLDQRMRYLESSRDLCSSMAAMLLARIPDPSWSRRLAMDLLNADMESY
FT                   VRHVRELAES"
     MSIRLDERRY VEELKRLVAD FRMWKNPLVP LPDGFEDDLA WRSYRVFGQT SPADIIALAV        60
     RTRDEDLVAQ GEGFISDSVS MIDDEDVFGW LFRMIWGKEL QLRQQIADAD VENLDATFDF       120
     LTSACRLAAH VLLGWGEGDT SSAYIARLFL IEQYDDALNC ILPYSNVSLN TNESELVVSD       180
     LRDRAIAAAM RRGETAAMEM KLHKAEDGPH YSSGEDSTAS DDGEGLDVAD DGRPFPQSDV       240
     LYLFDADHVI EAYRYFLDHA DGDADGDGEL DNGNPWRRPD FVQDKLLTLA GAGIVEPLVS       300
     TALEQGDGDR LEAALNLLTI YRGIVCDDGI LALPIIAART LQDSDGLRPD ADLDQRMRYL       360
     ESSRDLCSSM AAMLLARIPD PSWSRRLAMD LLNADMESYV RHVRELAES                   409
//

If you have problems or comments...

PBIL Back to PBIL home page