(data stored in ACNUC30630 zone)

EMBL: CP002010.PE456

CP002010.PE456       Location/Qualifiers
FT   CDS             complement(589236..589844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99955"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV0"
FT                   /protein_id="ADG99955.1"
FT                   /translation="MVDYDAAVAAVQDPNADPILLAKIAYENPEFGANVAVNPRCYPGL
FT                   KRWIAEFGDERARETLAQYGFTAEAFGGPVQDQEAPSQAALQAAEQQPADAYAADQYAA
FT                   AQPAADQYAAAQPAADQYAAQQPAAQAAFEEPVATNPYGFTAEQALTTTDQMQIAQIAQ
FT                   YAPELRACIARNPNTYPALIEWLGQLGDPAINAALASCQ"
     MVDYDAAVAA VQDPNADPIL LAKIAYENPE FGANVAVNPR CYPGLKRWIA EFGDERARET        60
     LAQYGFTAEA FGGPVQDQEA PSQAALQAAE QQPADAYAAD QYAAAQPAAD QYAAAQPAAD       120
     QYAAQQPAAQ AAFEEPVATN PYGFTAEQAL TTTDQMQIAQ IAQYAPELRA CIARNPNTYP       180
     ALIEWLGQLG DPAINAALAS CQ                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page