(data stored in ACNUC30630 zone)

EMBL: CP002010.PE459

CP002010.PE459       Location/Qualifiers
FT   CDS             complement(593310..594533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0482"
FT                   /product="protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99958"
FT                   /db_xref="GOA:D6ZSV3"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV3"
FT                   /protein_id="ADG99958.1"
FT                   /translation="MASTSAALRRRRRAERMFKRAVRRIRRFFASYVSPLGWAVTGAGI
FT                   ACLIAFLPLGWYELLVFGIVAMVMMLAAIALSLGNTRFHASIAVSDHRVTVGDTISVIV
FT                   GIDNTGKTPTTTARGYLPIGDAHERFNIPMLAPGQSKQTDVEFRTVSRAILPIGPLRIR
FT                   KGDPFGLVRHEKELADRIIVFIHPRTVRLDTLNAGVPRDLEGQPSGQIVDDDLDFYGLR
FT                   EYEPGDDVRNVHWLSSAKTGTLMIRQYEATRRTDTSVTISVNPDEYVNGEEFEMAVSIH
FT                   SSIGVKCLLQDRPLFCHAGNAHGQPRNAMEFLDNASAIEPDREDNPNLAEGTLKHSPDA
FT                   SFYFFTVGSLKDIEQIKRMTLALPRSASCVVLQASAGANRGIRRFANFTLATIGELDDL
FT                   PLIMGVLA"
     MASTSAALRR RRRAERMFKR AVRRIRRFFA SYVSPLGWAV TGAGIACLIA FLPLGWYELL        60
     VFGIVAMVMM LAAIALSLGN TRFHASIAVS DHRVTVGDTI SVIVGIDNTG KTPTTTARGY       120
     LPIGDAHERF NIPMLAPGQS KQTDVEFRTV SRAILPIGPL RIRKGDPFGL VRHEKELADR       180
     IIVFIHPRTV RLDTLNAGVP RDLEGQPSGQ IVDDDLDFYG LREYEPGDDV RNVHWLSSAK       240
     TGTLMIRQYE ATRRTDTSVT ISVNPDEYVN GEEFEMAVSI HSSIGVKCLL QDRPLFCHAG       300
     NAHGQPRNAM EFLDNASAIE PDREDNPNLA EGTLKHSPDA SFYFFTVGSL KDIEQIKRMT       360
     LALPRSASCV VLQASAGANR GIRRFANFTL ATIGELDDLP LIMGVLA                     407
//

If you have problems or comments...

PBIL Back to PBIL home page