(data stored in ACNUC30630 zone)

EMBL: CP002010.PE461

CP002010.PE461       Location/Qualifiers
FT   CDS             complement(596140..602124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0484"
FT                   /product="fibronectin type III domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99960"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV5"
FT                   /protein_id="ADG99960.1"
FT                   /translation="MATSSQSYDRRRRISAALRRLMPSGGHTWTVPVITLLLLLGLVAG
FT                   AVIMSTVTRRHVQLDDGTVWVTSLKNQKAARFNVKNKEADAGVSSSAPRFDIAQHNGDT
FT                   ILTETTKASTIKASTVSTGVKTDIKANTTTVVGGDTVALINEKTGNVWTGLSENLDSVA
FT                   PTTSDPKMKLGEGGRIVVTHDGKVYGYRPSDGMVLRLDNPSSAKAKTLESLTDGKQQTV
FT                   ESFTVIGSTPVIATGKTVIFKGGRVDVDTTGTLTLQEPPTDDVQSDWVAAASPRGLTLI
FT                   PLKSNAKANFIANGGKANPARPVSSKGCVYSAWSQKASNYIRACSPADTSVKPQTLESV
FT                   NTTSELVFRTNHRLVVLNDTVNGNVWNPEDSTKVIKIQWNKIQAEQTEKEQQNNDSANN
FT                   HHDFSKTCSAQSGQIKAEDDEIGARAGSEQILDVLRNDEQTDCSVLKITKVGAPNNKDV
FT                   TISPIYDGRYLQLDASATSAGTVTFTYDISDGRGQTSSATVTVTLNDGGNHAPVQFDTP
FT                   PEIDVEQGASYTANALSSFNDPDGDPLTLVSAVAQNTDPVQVSTRADGQLTFNTGALES
FT                   GRVGVEVTVSDGTATGTGMVYFSVKPANTLAAVIDPVAKTTVPNTDTVVKLSSYVHGTS
FT                   LQPAQLTQVDTPNGASTTTNAADMSLTFKATNPGTYYVPYTITQGSIPATGLARVEVQP
FT                   ATGEAAKPVAANDVALLGADNTAIVEPLTNDVDPMGGVLSVTTASAPADSGIKVGLVSH
FT                   KRVYITARQVPTKPVALTYTVANASGTAKGTIVLQPPALTTSNSVPKASNINAQVRTGG
FT                   IVSVDVLDHVAYSDGTTVKLKNNLQYDKETFKGLAFVSGDTVRYQASSETGNFPITYTV
FT                   EDNLGNVASANITITVHKSDAASKAAPTPHDAEAQVAAGQKVRIPITLTGIDTDGDDDQ
FT                   LLGLGNKAPTLGRISEVGSDYLVYEAYPDSSGTDTFSYAVEDWTGQRAQAQIRVGVFQG
FT                   SSDSGVYARDDEITLRPNTAATVPVAQNDISGDNTNLTVDKHVEVQGLDGVSVKDNMIS
FT                   FTTPGSATTAYIAYTVKDKAGLSDTATLTVNVDPNAAIEPPTAYDYRVPSAATIDKKSV
FT                   DVDVSQWIANPSGTANELKVGVHPSASAHAHVKGGEHSTTITVDLTSQARAVPYTVTNT
FT                   KYNITSTAFIQVPAYGVFPPTLRPKAPELKVNSRETIEININDYVRVGAGKEPYIESAD
FT                   SVSATKASNSDFYVNDKTLKFTAAKDYAGPASITFTAVDGKQGSDKTKIINSAVITLQI
FT                   TVIGRDVPPPTFSSSTIDVEAGADPKTVDLTALTHAPSGVYDDEKQYTYSGGSSSSGRI
FT                   TANLSRSGSLQVSATKDAAPGTTASIPVQIAYGAGTVNAGVTVRVVSSTRPLARVGDKT
FT                   LKIKAGASDAVNVLTGAYNPFPDSSLTVISCKADDAAKLTIAGCDASGNVTIAVASDPG
FT                   ASTNTVLVTVQDGSKSKDREVTASITVSVIDKPEPPLLSPVAGEPQDSAVSLTWTPGAA
FT                   NGSPITNYKVSWTGAATGEKDCGAVTSCQVTGLKNGKTYSFTVAARNDVGWSKPSTAVE
FT                   ATPDKVPSAPTDVTVTGGNKTAKVTWKAPSGDFSAVDNYSVTVTGAGAPQTKETGNTAT
FT                   ELSFTFNNNDISDGTAITATVKAHNKINWSAESAASPSEKIWGDPDAPNIALSNNDTTV
FT                   TAKVTLGNNRNAGCRRISLGGDVKDTIDCSDGGATFDINENDLNTREITVTATVVPQRD
FT                   ASAGTGKSRFVPQYKVQPPTDVYTTGSGSTCTVHWTKQGHAQSYNVTADGIDSGTATNR
FT                   NSLDFRMSPWAKCNTASVQQVFNGATSDAATGGPYNGAPYTYEKKAVINKPQELRWSDN
FT                   AHVINVTGGSVEVYGKQATVQIIINGQPFTWNPGQPLDVTDLAVAADGNYTWSVKVTGG
FT                   PGYSGLDNTADGSSVAGTRPSDSSEGTESLKSGTDVTTLAKNPWILGFGNTPISSITIH
FT                   KQ"
     MATSSQSYDR RRRISAALRR LMPSGGHTWT VPVITLLLLL GLVAGAVIMS TVTRRHVQLD        60
     DGTVWVTSLK NQKAARFNVK NKEADAGVSS SAPRFDIAQH NGDTILTETT KASTIKASTV       120
     STGVKTDIKA NTTTVVGGDT VALINEKTGN VWTGLSENLD SVAPTTSDPK MKLGEGGRIV       180
     VTHDGKVYGY RPSDGMVLRL DNPSSAKAKT LESLTDGKQQ TVESFTVIGS TPVIATGKTV       240
     IFKGGRVDVD TTGTLTLQEP PTDDVQSDWV AAASPRGLTL IPLKSNAKAN FIANGGKANP       300
     ARPVSSKGCV YSAWSQKASN YIRACSPADT SVKPQTLESV NTTSELVFRT NHRLVVLNDT       360
     VNGNVWNPED STKVIKIQWN KIQAEQTEKE QQNNDSANNH HDFSKTCSAQ SGQIKAEDDE       420
     IGARAGSEQI LDVLRNDEQT DCSVLKITKV GAPNNKDVTI SPIYDGRYLQ LDASATSAGT       480
     VTFTYDISDG RGQTSSATVT VTLNDGGNHA PVQFDTPPEI DVEQGASYTA NALSSFNDPD       540
     GDPLTLVSAV AQNTDPVQVS TRADGQLTFN TGALESGRVG VEVTVSDGTA TGTGMVYFSV       600
     KPANTLAAVI DPVAKTTVPN TDTVVKLSSY VHGTSLQPAQ LTQVDTPNGA STTTNAADMS       660
     LTFKATNPGT YYVPYTITQG SIPATGLARV EVQPATGEAA KPVAANDVAL LGADNTAIVE       720
     PLTNDVDPMG GVLSVTTASA PADSGIKVGL VSHKRVYITA RQVPTKPVAL TYTVANASGT       780
     AKGTIVLQPP ALTTSNSVPK ASNINAQVRT GGIVSVDVLD HVAYSDGTTV KLKNNLQYDK       840
     ETFKGLAFVS GDTVRYQASS ETGNFPITYT VEDNLGNVAS ANITITVHKS DAASKAAPTP       900
     HDAEAQVAAG QKVRIPITLT GIDTDGDDDQ LLGLGNKAPT LGRISEVGSD YLVYEAYPDS       960
     SGTDTFSYAV EDWTGQRAQA QIRVGVFQGS SDSGVYARDD EITLRPNTAA TVPVAQNDIS      1020
     GDNTNLTVDK HVEVQGLDGV SVKDNMISFT TPGSATTAYI AYTVKDKAGL SDTATLTVNV      1080
     DPNAAIEPPT AYDYRVPSAA TIDKKSVDVD VSQWIANPSG TANELKVGVH PSASAHAHVK      1140
     GGEHSTTITV DLTSQARAVP YTVTNTKYNI TSTAFIQVPA YGVFPPTLRP KAPELKVNSR      1200
     ETIEININDY VRVGAGKEPY IESADSVSAT KASNSDFYVN DKTLKFTAAK DYAGPASITF      1260
     TAVDGKQGSD KTKIINSAVI TLQITVIGRD VPPPTFSSST IDVEAGADPK TVDLTALTHA      1320
     PSGVYDDEKQ YTYSGGSSSS GRITANLSRS GSLQVSATKD AAPGTTASIP VQIAYGAGTV      1380
     NAGVTVRVVS STRPLARVGD KTLKIKAGAS DAVNVLTGAY NPFPDSSLTV ISCKADDAAK      1440
     LTIAGCDASG NVTIAVASDP GASTNTVLVT VQDGSKSKDR EVTASITVSV IDKPEPPLLS      1500
     PVAGEPQDSA VSLTWTPGAA NGSPITNYKV SWTGAATGEK DCGAVTSCQV TGLKNGKTYS      1560
     FTVAARNDVG WSKPSTAVEA TPDKVPSAPT DVTVTGGNKT AKVTWKAPSG DFSAVDNYSV      1620
     TVTGAGAPQT KETGNTATEL SFTFNNNDIS DGTAITATVK AHNKINWSAE SAASPSEKIW      1680
     GDPDAPNIAL SNNDTTVTAK VTLGNNRNAG CRRISLGGDV KDTIDCSDGG ATFDINENDL      1740
     NTREITVTAT VVPQRDASAG TGKSRFVPQY KVQPPTDVYT TGSGSTCTVH WTKQGHAQSY      1800
     NVTADGIDSG TATNRNSLDF RMSPWAKCNT ASVQQVFNGA TSDAATGGPY NGAPYTYEKK      1860
     AVINKPQELR WSDNAHVINV TGGSVEVYGK QATVQIIING QPFTWNPGQP LDVTDLAVAA      1920
     DGNYTWSVKV TGGPGYSGLD NTADGSSVAG TRPSDSSEGT ESLKSGTDVT TLAKNPWILG      1980
     FGNTPISSIT IHKQ                                                        1994
//

If you have problems or comments...

PBIL Back to PBIL home page