(data stored in ACNUC30630 zone)

EMBL: CP002010.PE487

CP002010.PE487       Location/Qualifiers
FT   CDS             639430..640260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0510"
FT                   /product="ABC-type polar amino acid transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99986"
FT                   /db_xref="GOA:D6ZSY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY1"
FT                   /protein_id="ADG99986.1"
FT                   /translation="MTTNDITNSAPVVRKAADGSVIPAVEAVQVHKAFGPLHVLKGIDL
FT                   TVMPGTVTVILGPSGSGKSTFLRLINQLETLTGGSIEVYGELIGYKHVTKNGQDMLQTL
FT                   DDKEIAAQRSRLGMVFQRFNLFPHMTALENVMEAPIHVQHQSKKAARDLAVAELQRVGL
FT                   GDRMDYYPSQLSGGQQQRVAIARALAMKPEIMLFDEPTSALDPELVGEVLNVMRSLAKE
FT                   GMTMVCVTHEIGFAREVADQIVFMDGGVVVEKGGPDIIDHPTEPRFKDFLQHVL"
     MTTNDITNSA PVVRKAADGS VIPAVEAVQV HKAFGPLHVL KGIDLTVMPG TVTVILGPSG        60
     SGKSTFLRLI NQLETLTGGS IEVYGELIGY KHVTKNGQDM LQTLDDKEIA AQRSRLGMVF       120
     QRFNLFPHMT ALENVMEAPI HVQHQSKKAA RDLAVAELQR VGLGDRMDYY PSQLSGGQQQ       180
     RVAIARALAM KPEIMLFDEP TSALDPELVG EVLNVMRSLA KEGMTMVCVT HEIGFAREVA       240
     DQIVFMDGGV VVEKGGPDII DHPTEPRFKD FLQHVL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page