(data stored in ACNUC30630 zone)

EMBL: CP002010.PE49

CP002010.PE49        Location/Qualifiers
FT   CDS             complement(69635..70516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0052"
FT                   /product="protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99548"
FT                   /db_xref="GOA:D6ZXA2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA2"
FT                   /protein_id="ADG99548.1"
FT                   /translation="MGEVWKGYDIQLGREVAIKALRSDVTNAEAKLRRLRAEAHNSANL
FT                   AHPNIAALFEYYEHDGIGFLIMEYVPSKSLADLFHSKGAMDPIELLPILIQTARGLFVA
FT                   HSHGVIHRDVKPANIMVSDTGEVKITDFGVSYSTGQGQITQDGMVVGTAQYISPEQAQG
FT                   QQATPQSDIYSLGVVAYEGLAGHRPFTGTTPVDIAAAHVNNPVPPLPNSVDVQLREFVM
FT                   SMLAKDPLDRPKDALVVSRTLARIERRLLDQQTEMADTTMATSGNRLPRRVTSTPRIVL
FT                   EAPASRLGGNKQ"
     MGEVWKGYDI QLGREVAIKA LRSDVTNAEA KLRRLRAEAH NSANLAHPNI AALFEYYEHD        60
     GIGFLIMEYV PSKSLADLFH SKGAMDPIEL LPILIQTARG LFVAHSHGVI HRDVKPANIM       120
     VSDTGEVKIT DFGVSYSTGQ GQITQDGMVV GTAQYISPEQ AQGQQATPQS DIYSLGVVAY       180
     EGLAGHRPFT GTTPVDIAAA HVNNPVPPLP NSVDVQLREF VMSMLAKDPL DRPKDALVVS       240
     RTLARIERRL LDQQTEMADT TMATSGNRLP RRVTSTPRIV LEAPASRLGG NKQ              293
//

If you have problems or comments...

PBIL Back to PBIL home page