(data stored in ACNUC30630 zone)

EMBL: CP002010.PE500

CP002010.PE500       Location/Qualifiers
FT   CDS             655344..656687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0523"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99999"
FT                   /db_xref="GOA:D6ZSZ4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ4"
FT                   /protein_id="ADG99999.1"
FT                   /translation="MKFTVAKKAIALTGAVAMLGSVAACGSDTASGKPAQDKDVTEITV
FT                   WAWEPTLTQVAKDFTKKTGIKVDLKNVGTNTKEYTQLDNAIEAGSGAPDVAQVEYYAIP
FT                   QYAIKGNLLDITDKTSGYSDFYTPGPWASVQFAGKVYGLPMDSGPMAFFYNKEVFDKAG
FT                   VDAEQIKTWDQYYDAAKKIHALGDNYYITSDTGDAGFFDSMTWLAGAKPFQTSSDGSEV
FT                   TVNLTEDKGVKTFTDFWQKLLDEGLLDTKTAGWSEDWFKGMVDGTIASLFTGAWMPANL
FT                   ANSAADGAGKWRVTQMPTADGSTTNSENGGSSLAVLASTKKADAAYQFIEYANHGDGVA
FT                   TRVAGGAFPADKASMESDSFKNTTTVKNADGEDVDYFGGQKYNEVLAQAAENVSSDYQF
FT                   LPYEVKARTIFGDYLGKSYTGDQKLTDGIAAWQKALQDYGKDQGFTVK"
     MKFTVAKKAI ALTGAVAMLG SVAACGSDTA SGKPAQDKDV TEITVWAWEP TLTQVAKDFT        60
     KKTGIKVDLK NVGTNTKEYT QLDNAIEAGS GAPDVAQVEY YAIPQYAIKG NLLDITDKTS       120
     GYSDFYTPGP WASVQFAGKV YGLPMDSGPM AFFYNKEVFD KAGVDAEQIK TWDQYYDAAK       180
     KIHALGDNYY ITSDTGDAGF FDSMTWLAGA KPFQTSSDGS EVTVNLTEDK GVKTFTDFWQ       240
     KLLDEGLLDT KTAGWSEDWF KGMVDGTIAS LFTGAWMPAN LANSAADGAG KWRVTQMPTA       300
     DGSTTNSENG GSSLAVLAST KKADAAYQFI EYANHGDGVA TRVAGGAFPA DKASMESDSF       360
     KNTTTVKNAD GEDVDYFGGQ KYNEVLAQAA ENVSSDYQFL PYEVKARTIF GDYLGKSYTG       420
     DQKLTDGIAA WQKALQDYGK DQGFTVK                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page