(data stored in ACNUC30630 zone)

EMBL: CP002010.PE504

CP002010.PE504       Location/Qualifiers
FT   CDS             660637..662304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0527"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00004"
FT                   /db_xref="GOA:D6ZSZ8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ8"
FT                   /protein_id="ADH00004.1"
FT                   /translation="MSQNNGVHGESGATEDRNTSGADQAASTDASLNARAKSSNKKNGG
FT                   PKWWLWTLIAVVVAAALIVGVTVFGGKGKGKDANASGSASRSDTVAVGLKLAPVNLDIR
FT                   HQSGSALEQILIGNVYEGLVSRGSDNKVHPGLAKSWEISKDGLTYTFHLNEKMNFSNGD
FT                   KLDAEDVAWSINELKAQKYYDYEQVKSLDKAEAVDANTVRLTLSAPNSNMLWYLTSRPG
FT                   LVYDKDATWDQKNGALGSGPYTVVSFDPNDKIVLKANPKYWGTEHKARTENVIVRFLPD
FT                   ENASINALKSGDVQVLSSIIPATLAEPFRKDPNYVVKVGGGSDKFVLAFNMANDKLSDK
FT                   RVRQAIRYAIDHKQIIASRGGVDAPLGGPIPEMDPGYEDLSGLYPHDVAKAKKLMEQAG
FT                   YSESKPLDLTLTYANVYGTELGDQLKSQLKPIGIDLKINYVEFSTWLQDVHANGNYDLS
FT                   LVDHAESHDFYGWTTPSYYFHYDNKDVQALYAKALEATSDDEASKYLAKAAKIVSEDAP
FT                   ADWLFSLKVTIAYAKGVNGVPQDFIQTVLPLWRITYTK"
     MSQNNGVHGE SGATEDRNTS GADQAASTDA SLNARAKSSN KKNGGPKWWL WTLIAVVVAA        60
     ALIVGVTVFG GKGKGKDANA SGSASRSDTV AVGLKLAPVN LDIRHQSGSA LEQILIGNVY       120
     EGLVSRGSDN KVHPGLAKSW EISKDGLTYT FHLNEKMNFS NGDKLDAEDV AWSINELKAQ       180
     KYYDYEQVKS LDKAEAVDAN TVRLTLSAPN SNMLWYLTSR PGLVYDKDAT WDQKNGALGS       240
     GPYTVVSFDP NDKIVLKANP KYWGTEHKAR TENVIVRFLP DENASINALK SGDVQVLSSI       300
     IPATLAEPFR KDPNYVVKVG GGSDKFVLAF NMANDKLSDK RVRQAIRYAI DHKQIIASRG       360
     GVDAPLGGPI PEMDPGYEDL SGLYPHDVAK AKKLMEQAGY SESKPLDLTL TYANVYGTEL       420
     GDQLKSQLKP IGIDLKINYV EFSTWLQDVH ANGNYDLSLV DHAESHDFYG WTTPSYYFHY       480
     DNKDVQALYA KALEATSDDE ASKYLAKAAK IVSEDAPADW LFSLKVTIAY AKGVNGVPQD       540
     FIQTVLPLWR ITYTK                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page