(data stored in ACNUC30630 zone)

EMBL: CP002010.PE526

CP002010.PE526       Location/Qualifiers
FT   CDS             complement(687732..687992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00026"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT20"
FT                   /protein_id="ADH00026.1"
FT                   /translation="MFINLFRRQRPALARLARNSNAYRQPMVAAVSSSAVGVSSITSAS
FT                   TTANTDGVSGVSTLDATIGRIHDIPQSAMSRLTGSPTVYAR"
     MFINLFRRQR PALARLARNS NAYRQPMVAA VSSSAVGVSS ITSASTTANT DGVSGVSTLD        60
     ATIGRIHDIP QSAMSRLTGS PTVYAR                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page