(data stored in ACNUC30630 zone)

EMBL: CP002010.PE531

CP002010.PE531       Location/Qualifiers
FT   CDS             693916..695082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00031"
FT                   /db_xref="GOA:D6ZT25"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036238"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT25"
FT                   /protein_id="ADH00031.1"
FT                   /translation="MKHLSHHTIAIIVALLSTLSLALAVISLPHQAYAVDGTDGTSGTN
FT                   STSQGSDGDSAPIAGPVPNIIITNFAYGGDSVAAGSKFNLDFTFQNKGQVAVTNMVVTV
FT                   DGGESFAIAGGTNTFYVDALWAGYAMTQSVPMQALASAKSGAQSVTVNFRYEYVDASAR
FT                   SSSQSDVKISVPISQPDRFEISDPVVPDQVIAGQENTVTMEYVNKGKGDIANVEATMEG
FT                   EGFDATMKTQYVGNVASGATGTIGYAFTPHASGELKTTLKVTYEDSDGQTKTKEFPLAI
FT                   PVTDMQPVDDSDMADPNMDQSANQGFPVLVYVVIVVIAVVIIVVIVLLVRRRRKQKAKK
FT                   NDIDEDWDDWSEGKDDKTDTDVTDGAAADTAPIAPASPASPAGPSHKA"
     MKHLSHHTIA IIVALLSTLS LALAVISLPH QAYAVDGTDG TSGTNSTSQG SDGDSAPIAG        60
     PVPNIIITNF AYGGDSVAAG SKFNLDFTFQ NKGQVAVTNM VVTVDGGESF AIAGGTNTFY       120
     VDALWAGYAM TQSVPMQALA SAKSGAQSVT VNFRYEYVDA SARSSSQSDV KISVPISQPD       180
     RFEISDPVVP DQVIAGQENT VTMEYVNKGK GDIANVEATM EGEGFDATMK TQYVGNVASG       240
     ATGTIGYAFT PHASGELKTT LKVTYEDSDG QTKTKEFPLA IPVTDMQPVD DSDMADPNMD       300
     QSANQGFPVL VYVVIVVIAV VIIVVIVLLV RRRRKQKAKK NDIDEDWDDW SEGKDDKTDT       360
     DVTDGAAADT APIAPASPAS PAGPSHKA                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page