(data stored in ACNUC30630 zone)

EMBL: CP002010.PE54

CP002010.PE54        Location/Qualifiers
FT   CDS             complement(75941..76642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0057"
FT                   /product="FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99553"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA7"
FT                   /protein_id="ADG99553.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLQPVDLSSALEREIDAEAM
FT                   PVGRDRTVAPNEYRFKLSTPDFDRIEAWGSETLANELADNLTEYAKSQHYAFVGPVIVI
FT                   FEEDLDLSKGNFNLTSESVQGNAVPVTTDAQTEDSPVLEVNGNQYLLTKDKTVIGRGSG
FT                   CDIVIDDPGISRKHLEIDITDNGVIARDLGSTNGTYVEGHQVPAATLLDGNTITIGRTR
FT                   ILYWASAQAQE"
     MSVLDRFEKS VEGAVNGVFA KFGSKDLQPV DLSSALEREI DAEAMPVGRD RTVAPNEYRF        60
     KLSTPDFDRI EAWGSETLAN ELADNLTEYA KSQHYAFVGP VIVIFEEDLD LSKGNFNLTS       120
     ESVQGNAVPV TTDAQTEDSP VLEVNGNQYL LTKDKTVIGR GSGCDIVIDD PGISRKHLEI       180
     DITDNGVIAR DLGSTNGTYV EGHQVPAATL LDGNTITIGR TRILYWASAQ AQE              233
//

If you have problems or comments...

PBIL Back to PBIL home page