(data stored in ACNUC30630 zone)

EMBL: CP002010.PE547

CP002010.PE547       Location/Qualifiers
FT   CDS             717015..718610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0571"
FT                   /product="UMUC domain protein DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00047"
FT                   /db_xref="GOA:D6ZT41"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT41"
FT                   /protein_id="ADH00047.1"
FT                   /translation="MAMAGERASAQREHTYIAIDLKSFYASVECAARGLDPLTTHLVVA
FT                   DETRTDKTICLAVSPSLKSYGIPGRARLFEVKQRLNGVNAERAVHAPGGRLIGESCDAR
FT                   DLEHSPRLKASMVIAKPRMAHYLEISGRIYGIYLRYAAPEHIHVYSIDEVFIDATPYLR
FT                   SLGMGAHAMARTIVREILAETGITATAGIGSNMYLAKVAMDIVAKHMPADKDGVRVAEL
FT                   NEMSYRRLLWDHRPLTDFWRVGRGYAKKLEHAGLMTMGDIARCSVGRASDYYNEDLLYR
FT                   MFGVNAELLIDHAWGWEPCEIADIQSYEPDAHSISSGQVLTGPADYATARLITKEMADA
FT                   LALDLVDKGVLTNRLTLAVGYDIGSLDASKLDSCADYAMKRAAERAAKSYQGPVAVDRF
FT                   GRKVPKSAVGSIGLGDFTSSSARIREAMTMLYGRIVDSRLLVRRLTVIADDVATPEELA
FT                   AGKRYEQLDLFGDDEAQSYGSEPADDRDGEHDIQRALLDVKRKFGRNAVIKAMDMEDGA
FT                   TGQGRNRQIGGHRA"
     MAMAGERASA QREHTYIAID LKSFYASVEC AARGLDPLTT HLVVADETRT DKTICLAVSP        60
     SLKSYGIPGR ARLFEVKQRL NGVNAERAVH APGGRLIGES CDARDLEHSP RLKASMVIAK       120
     PRMAHYLEIS GRIYGIYLRY AAPEHIHVYS IDEVFIDATP YLRSLGMGAH AMARTIVREI       180
     LAETGITATA GIGSNMYLAK VAMDIVAKHM PADKDGVRVA ELNEMSYRRL LWDHRPLTDF       240
     WRVGRGYAKK LEHAGLMTMG DIARCSVGRA SDYYNEDLLY RMFGVNAELL IDHAWGWEPC       300
     EIADIQSYEP DAHSISSGQV LTGPADYATA RLITKEMADA LALDLVDKGV LTNRLTLAVG       360
     YDIGSLDASK LDSCADYAMK RAAERAAKSY QGPVAVDRFG RKVPKSAVGS IGLGDFTSSS       420
     ARIREAMTML YGRIVDSRLL VRRLTVIADD VATPEELAAG KRYEQLDLFG DDEAQSYGSE       480
     PADDRDGEHD IQRALLDVKR KFGRNAVIKA MDMEDGATGQ GRNRQIGGHR A                531
//

If you have problems or comments...

PBIL Back to PBIL home page