(data stored in ACNUC30630 zone)

EMBL: CP002010.PE548

CP002010.PE548       Location/Qualifiers
FT   CDS             718607..718825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00048"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT42"
FT                   /protein_id="ADH00048.1"
FT                   /translation="MTLQETHAYDDIINLPHHQSRKHPHMSRHQRAAQFMPFAALTGYG
FT                   QVIEQTAKNAETAIAQAEAQGDTDFGA"
     MTLQETHAYD DIINLPHHQS RKHPHMSRHQ RAAQFMPFAA LTGYGQVIEQ TAKNAETAIA        60
     QAEAQGDTDF GA                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page