(data stored in ACNUC30630 zone)

EMBL: CP002010.PE55

CP002010.PE55        Location/Qualifiers
FT   CDS             complement(76865..79309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0058"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99554"
FT                   /db_xref="GOA:D6ZXA8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA8"
FT                   /protein_id="ADG99554.1"
FT                   /translation="MSETNDVNDAIKHFPRLRARTLRFGCGAPRSAQTVGDGSRALFLR
FT                   SDGPEDLVTALWLSWFDESGEHHETKLADPRELLGATADSEDVPAEEKARRERAREGGT
FT                   GIVGYSADDDGNRIVFTINGRLFLTEIAWNDETGAPEPHTRELASEWLDEDPEMYTPVL
FT                   NPRIAPDGEHVLYTTGSYLMLVDIGGELGDRITAVYGVSVEDEDGNPAENTWKIGLAEF
FT                   VAGEEMDRYDGFWWAPDSQHVLFESFDTADEPTWYISDPADPEKPAAGRRYPRALTRNA
FT                   DVYLTVITLAFDENDRYAGITGNADVDWDREAYEYVAAVSWRRGHDPLVLVQNRRQTRD
FT                   QVLEVAVAADGAALGATRVLEEHANEQWIDLVHGTPAYTPDDRLVCSLNDMATDTNRLT
FT                   VDGRPFTPAGWNVRTVLAVTDEDVLAVVQRAPEIATEVPRAWAGSGAASDAESLFGGHD
FT                   ARSFDVVSMGYDGSVAPITTEPGQWTASRGARGMVVSGRDMRSARARMRHIVTRRAVGG
FT                   VTDAVIAANTSDAANTSDITAADITSTAAEPGFTPNVTFTRLGEHRLYTAIIAPSPSSP
FT                   YAHADKLPVLMKPYGGPGFQQVVASQSFYWEGQWWADQGFLVVTADGRGTTGRGPAWDR
FT                   AIFENMKGVTLADQIEAVNALPEAVSRLNADGRRPGVPAPDLDKVCMIGWSYGGFLSAL
FT                   AVLDAPNVFKAACAGAPPTDWTLYDTHYTERYLGLDPDVYYRNGIVQDAPKLERPLMLI
FT                   HGFADDNVTIAHSLRLSQALMAAGRPHTFLPLTGITHMTNDETVAENLLTLQRDFLRDA
FT                   LA"
     MSETNDVNDA IKHFPRLRAR TLRFGCGAPR SAQTVGDGSR ALFLRSDGPE DLVTALWLSW        60
     FDESGEHHET KLADPRELLG ATADSEDVPA EEKARRERAR EGGTGIVGYS ADDDGNRIVF       120
     TINGRLFLTE IAWNDETGAP EPHTRELASE WLDEDPEMYT PVLNPRIAPD GEHVLYTTGS       180
     YLMLVDIGGE LGDRITAVYG VSVEDEDGNP AENTWKIGLA EFVAGEEMDR YDGFWWAPDS       240
     QHVLFESFDT ADEPTWYISD PADPEKPAAG RRYPRALTRN ADVYLTVITL AFDENDRYAG       300
     ITGNADVDWD REAYEYVAAV SWRRGHDPLV LVQNRRQTRD QVLEVAVAAD GAALGATRVL       360
     EEHANEQWID LVHGTPAYTP DDRLVCSLND MATDTNRLTV DGRPFTPAGW NVRTVLAVTD       420
     EDVLAVVQRA PEIATEVPRA WAGSGAASDA ESLFGGHDAR SFDVVSMGYD GSVAPITTEP       480
     GQWTASRGAR GMVVSGRDMR SARARMRHIV TRRAVGGVTD AVIAANTSDA ANTSDITAAD       540
     ITSTAAEPGF TPNVTFTRLG EHRLYTAIIA PSPSSPYAHA DKLPVLMKPY GGPGFQQVVA       600
     SQSFYWEGQW WADQGFLVVT ADGRGTTGRG PAWDRAIFEN MKGVTLADQI EAVNALPEAV       660
     SRLNADGRRP GVPAPDLDKV CMIGWSYGGF LSALAVLDAP NVFKAACAGA PPTDWTLYDT       720
     HYTERYLGLD PDVYYRNGIV QDAPKLERPL MLIHGFADDN VTIAHSLRLS QALMAAGRPH       780
     TFLPLTGITH MTNDETVAEN LLTLQRDFLR DALA                                   814
//

If you have problems or comments...

PBIL Back to PBIL home page