(data stored in ACNUC30630 zone)

EMBL: CP002010.PE553

CP002010.PE553       Location/Qualifiers
FT   CDS             complement(723352..724152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00053"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT47"
FT                   /protein_id="ADH00053.1"
FT                   /translation="MVVINAIYKKALRARLWQPTKWGKRLLKSKDAAGGFRKMLVSEGG
FT                   KAMQSGENVLSAIRHDGTGNYAANLARQGWDALGKGMHNVGHSLKNSGRAWNRFVSGWQ
FT                   DAKQAANAAHSNPNNTVMRDFWDGQFKRFGDWSKGHGWSIGNTIMNARTGYTDFRGIHD
FT                   MKNIAAVDTRRTVWDTMNFGQHVVSYANATYDTLNTAKVVKPFVNPTTDGGLQWKHSPQ
FT                   DYFKTFVPDPDQLWNFKTIYQAPGKLSDGAAEASNAIRVGISDL"
     MVVINAIYKK ALRARLWQPT KWGKRLLKSK DAAGGFRKML VSEGGKAMQS GENVLSAIRH        60
     DGTGNYAANL ARQGWDALGK GMHNVGHSLK NSGRAWNRFV SGWQDAKQAA NAAHSNPNNT       120
     VMRDFWDGQF KRFGDWSKGH GWSIGNTIMN ARTGYTDFRG IHDMKNIAAV DTRRTVWDTM       180
     NFGQHVVSYA NATYDTLNTA KVVKPFVNPT TDGGLQWKHS PQDYFKTFVP DPDQLWNFKT       240
     IYQAPGKLSD GAAEASNAIR VGISDL                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page