(data stored in ACNUC30630 zone)

EMBL: CP002010.PE555

CP002010.PE555       Location/Qualifiers
FT   CDS             724718..725530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00055"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT49"
FT                   /protein_id="ADH00055.1"
FT                   /translation="MISYVRNVGKTVLAAVVSLVFIVGAAGCGNTQKDDGPDYADDEAM
FT                   SIIAKAYQKRSDVLDQYEQKKDTDSVKHVKDAVQAEIDNDEPLKERQFKDSKLQEKVIT
FT                   YINLLEDSQKVNEDYSYLSSDYSTEWTKVYDKRSALLKDFVDNYKLTVDSKYQDPLNDI
FT                   VANGSSVKKKTETEDALNNLIASATFEKTDDGYGYYAYSAVIENISGIDFGTVNLILAL
FT                   YDADGVKAAEVYASTNAWPAGEKVKFETGSDADAAQVKASVDHYEVDD"
     MISYVRNVGK TVLAAVVSLV FIVGAAGCGN TQKDDGPDYA DDEAMSIIAK AYQKRSDVLD        60
     QYEQKKDTDS VKHVKDAVQA EIDNDEPLKE RQFKDSKLQE KVITYINLLE DSQKVNEDYS       120
     YLSSDYSTEW TKVYDKRSAL LKDFVDNYKL TVDSKYQDPL NDIVANGSSV KKKTETEDAL       180
     NNLIASATFE KTDDGYGYYA YSAVIENISG IDFGTVNLIL ALYDADGVKA AEVYASTNAW       240
     PAGEKVKFET GSDADAAQVK ASVDHYEVDD                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page