(data stored in ACNUC30630 zone)

EMBL: CP002010.PE577

CP002010.PE577       Location/Qualifiers
FT   CDS             complement(748512..749048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0602"
FT                   /product="Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00077"
FT                   /db_xref="GOA:D6ZT71"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT71"
FT                   /protein_id="ADH00077.1"
FT                   /translation="MGSQSPSADARPGTRTATPPAHKLPDIHLDIVLVVFCGGAIGTAI
FT                   RYAFAQIPAAGSFHTGTFVANMLACFCYAGLTAYLAGSSRFRARAKELASRGLGMGVCG
FT                   GLSTMSTLALEGFTAIRDGQVAAGIAYLLVTFALGLVCASAGVWAGTHLAGSSNASAEA
FT                   SADTNAATTSKGGKA"
     MGSQSPSADA RPGTRTATPP AHKLPDIHLD IVLVVFCGGA IGTAIRYAFA QIPAAGSFHT        60
     GTFVANMLAC FCYAGLTAYL AGSSRFRARA KELASRGLGM GVCGGLSTMS TLALEGFTAI       120
     RDGQVAAGIA YLLVTFALGL VCASAGVWAG THLAGSSNAS AEASADTNAA TTSKGGKA         178
//

If you have problems or comments...

PBIL Back to PBIL home page