(data stored in ACNUC30630 zone)

EMBL: CP002010.PE581

CP002010.PE581       Location/Qualifiers
FT   CDS             complement(752888..753760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00081"
FT                   /db_xref="GOA:D6ZT75"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR032160"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT75"
FT                   /protein_id="ADH00081.1"
FT                   /translation="MSTKTAAPRFGRERYADINIDLNRACDQSPFVIAAHRGTPRGDIR
FT                   ENTLNGVIATTKVNADIAEIDVIRSTDGEYFAFHDGTEMARLRITDDILSKTAAELDEL
FT                   RYTEYPGAYYGNVERVAHILSNAPDILINIDRSWRYWSTGFLDWLDQFHLERKLILKCP
FT                   VAEGFQQALHDHETKYMFMGMIQSPDELDLFVDDEQINTVGVELVATTEDTPLADPAVF
FT                   RTISEHGLYSFVNALDLGNGYCGLKGMDDTRSILEGPQHGWGALLTLGANVIQTDWPEK
FT                   LDEYRRVIA"
     MSTKTAAPRF GRERYADINI DLNRACDQSP FVIAAHRGTP RGDIRENTLN GVIATTKVNA        60
     DIAEIDVIRS TDGEYFAFHD GTEMARLRIT DDILSKTAAE LDELRYTEYP GAYYGNVERV       120
     AHILSNAPDI LINIDRSWRY WSTGFLDWLD QFHLERKLIL KCPVAEGFQQ ALHDHETKYM       180
     FMGMIQSPDE LDLFVDDEQI NTVGVELVAT TEDTPLADPA VFRTISEHGL YSFVNALDLG       240
     NGYCGLKGMD DTRSILEGPQ HGWGALLTLG ANVIQTDWPE KLDEYRRVIA                  290
//

If you have problems or comments...

PBIL Back to PBIL home page