(data stored in ACNUC30630 zone)

EMBL: CP002010.PE59

CP002010.PE59        Location/Qualifiers
FT   CDS             82941..84038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99558"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB2"
FT                   /protein_id="ADG99558.1"
FT                   /translation="MKLSKSKIIGLIALLAVVGVVCGTLVWRQSQPAPAEPTEQVSITG
FT                   YLGGEKIGLFDDAKFKALAAKQGIAIDYRKAGSLAMMDADRKGMDYLFPSSRAAVEYGN
FT                   AKGVKAIQSDIVFNSPIVLYTHKAVADGLVNGGLMTKDDSGAYHMDMAKAVDAMVANTT
FT                   WADVGYTAGYGQFRIDSTDPVKSNSGNEYAALLATVLNGGQPATVDSVARDGKTIASIF
FT                   AKSGWMETSSEDSFNQFLTLGVGSKPMMVGYESQLLDLAVNQPDAFKQIKDDVVIVYPT
FT                   PTVWSTHTLMALDEKGGTLLNLLKTPAVQKLAWERHGFRAANFAGTDSISRFGVPGTLD
FT                   QIPAVSELPNNDAMQQLIATLQSTQ"
     MKLSKSKIIG LIALLAVVGV VCGTLVWRQS QPAPAEPTEQ VSITGYLGGE KIGLFDDAKF        60
     KALAAKQGIA IDYRKAGSLA MMDADRKGMD YLFPSSRAAV EYGNAKGVKA IQSDIVFNSP       120
     IVLYTHKAVA DGLVNGGLMT KDDSGAYHMD MAKAVDAMVA NTTWADVGYT AGYGQFRIDS       180
     TDPVKSNSGN EYAALLATVL NGGQPATVDS VARDGKTIAS IFAKSGWMET SSEDSFNQFL       240
     TLGVGSKPMM VGYESQLLDL AVNQPDAFKQ IKDDVVIVYP TPTVWSTHTL MALDEKGGTL       300
     LNLLKTPAVQ KLAWERHGFR AANFAGTDSI SRFGVPGTLD QIPAVSELPN NDAMQQLIAT       360
     LQSTQ                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page