(data stored in ACNUC30630 zone)

EMBL: CP002010.PE6

CP002010.PE6         Location/Qualifiers
FT   CDS             7644..10295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99505"
FT                   /db_xref="GOA:D6ZX59"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX59"
FT                   /protein_id="ADG99505.1"
FT                   /translation="MADENNTGDEQFTPDGSMEPLSPQEADTTDYGLMDTGERIQRKDL
FT                   QQEMRESYLAYALSVIVERALPDVRDGMKPVHRRVIYAMYDGGYRPDRGYNKCSRVVGD
FT                   VMGKYHPHGDSAIYDTLVRMAQSWSMRNMLVDGQGNFGSPGDDPAAAMRYTECRMAPLA
FT                   MEMVRDIDKDTVDFVPNYDGKTQEPTVLPARFPNLLVNGSAGIAVGMATNIPPHNMREV
FT                   ADGVHWALDHPDASREELLENLIRIIKGPDFPTGATILGHKGIEQAYRTGRGLITMRAV
FT                   VNTEEINGRMCLVVTELPYQVNPDRLVVSIREAVRDGKIQGIADMRDETSGRTGQRLVL
FT                   VLKRDAVPKVVLNNLYKHSQLQQTFGANMLALVDGVPRTLSLDAFIRHWVNHQLDVIAR
FT                   RTAYLKREAEERDHILQGYLKALDMLDEVIALIRASEDTDTARTGLMGLLDIDQVQADA
FT                   ILAMQLRTLTRMNRDKIVAEHEELQRKIADYIDILAKPERQRKIIGDELDEIVAKYGDD
FT                   RRTKILPFSGEMNVEDLIAEENVVVTVTHSGFIKRTKADEYRAQHRGGKGIKGTKLRED
FT                   DVVDHFFLTSTHNWLLFFTNKGRVYRIKAYELPEGSRDSKGQHVANLLQFAPDETIQTV
FT                   LSIPNYEVAKYLVLATRSGKVKKTPLAEYDSPRQGGLIAVRLMADENGENADELIGAAL
FT                   CNAEDDIILVSKLGMSLKFQADDEQLRPMGRQTAGVQGMKFRNDDSLLAMDVVPGDSDK
FT                   DLFVVTNEGFAKRTAISEYRLQGRNGLGIKAVQLVEGRGALVGALVVSEDDQVMAIMKS
FT                   GKVIRSNVDEVKRTGRNTQGVTFAKPDKGDTILSIARNEEKDEPEDSGDAAANGTAESA
FT                   QSGENVNNADEA"
     MADENNTGDE QFTPDGSMEP LSPQEADTTD YGLMDTGERI QRKDLQQEMR ESYLAYALSV        60
     IVERALPDVR DGMKPVHRRV IYAMYDGGYR PDRGYNKCSR VVGDVMGKYH PHGDSAIYDT       120
     LVRMAQSWSM RNMLVDGQGN FGSPGDDPAA AMRYTECRMA PLAMEMVRDI DKDTVDFVPN       180
     YDGKTQEPTV LPARFPNLLV NGSAGIAVGM ATNIPPHNMR EVADGVHWAL DHPDASREEL       240
     LENLIRIIKG PDFPTGATIL GHKGIEQAYR TGRGLITMRA VVNTEEINGR MCLVVTELPY       300
     QVNPDRLVVS IREAVRDGKI QGIADMRDET SGRTGQRLVL VLKRDAVPKV VLNNLYKHSQ       360
     LQQTFGANML ALVDGVPRTL SLDAFIRHWV NHQLDVIARR TAYLKREAEE RDHILQGYLK       420
     ALDMLDEVIA LIRASEDTDT ARTGLMGLLD IDQVQADAIL AMQLRTLTRM NRDKIVAEHE       480
     ELQRKIADYI DILAKPERQR KIIGDELDEI VAKYGDDRRT KILPFSGEMN VEDLIAEENV       540
     VVTVTHSGFI KRTKADEYRA QHRGGKGIKG TKLREDDVVD HFFLTSTHNW LLFFTNKGRV       600
     YRIKAYELPE GSRDSKGQHV ANLLQFAPDE TIQTVLSIPN YEVAKYLVLA TRSGKVKKTP       660
     LAEYDSPRQG GLIAVRLMAD ENGENADELI GAALCNAEDD IILVSKLGMS LKFQADDEQL       720
     RPMGRQTAGV QGMKFRNDDS LLAMDVVPGD SDKDLFVVTN EGFAKRTAIS EYRLQGRNGL       780
     GIKAVQLVEG RGALVGALVV SEDDQVMAIM KSGKVIRSNV DEVKRTGRNT QGVTFAKPDK       840
     GDTILSIARN EEKDEPEDSG DAAANGTAES AQSGENVNNA DEA                         883
//

If you have problems or comments...

PBIL Back to PBIL home page