(data stored in ACNUC30630 zone)

EMBL: CP002010.PE622

CP002010.PE622       Location/Qualifiers
FT   CDS             800133..800489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0647"
FT                   /product="Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00122"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB6"
FT                   /protein_id="ADH00122.1"
FT                   /translation="MPIALHNAVVDDESSQSSYRRITPAEFAKLDPNTVTLLDLREPAD
FT                   FAAHPVEGAINAPLDPLAHVLKTVPTDRTVVVYCAQGWWSEEVAEILADRGYDVASLDG
FT                   GFQGYLDYLETHHD"
     MPIALHNAVV DDESSQSSYR RITPAEFAKL DPNTVTLLDL REPADFAAHP VEGAINAPLD        60
     PLAHVLKTVP TDRTVVVYCA QGWWSEEVAE ILADRGYDVA SLDGGFQGYL DYLETHHD         118
//

If you have problems or comments...

PBIL Back to PBIL home page