(data stored in ACNUC30630 zone)

EMBL: CP002010.PE630

CP002010.PE630       Location/Qualifiers
FT   CDS             complement(807373..808047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00130"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC4"
FT                   /protein_id="ADH00130.1"
FT                   /translation="MGKHTQNCTLIGKGVYGTIGVDQRSRLADGAHFHTMIVTSTLEAS
FT                   VIEGDKLVIKSGIVRCDGDIRVSSISGSGDIEVGGDIICDEITFTGKLRCNSDIVCSGN
FT                   LSVNGSLGTRHISGQTVRLNGVLKGHDVNSRALEVHPLRSTMFSRFDMDGYEDGSMVRH
FT                   ITAVTVEANHLQCRTLTADSAMLRNGSAVESATCATAIGIDRTSSVLLVNGDCRRIHLK
FT                   TA"
     MGKHTQNCTL IGKGVYGTIG VDQRSRLADG AHFHTMIVTS TLEASVIEGD KLVIKSGIVR        60
     CDGDIRVSSI SGSGDIEVGG DIICDEITFT GKLRCNSDIV CSGNLSVNGS LGTRHISGQT       120
     VRLNGVLKGH DVNSRALEVH PLRSTMFSRF DMDGYEDGSM VRHITAVTVE ANHLQCRTLT       180
     ADSAMLRNGS AVESATCATA IGIDRTSSVL LVNGDCRRIH LKTA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page