(data stored in ACNUC30630 zone)

EMBL: CP002010.PE637

CP002010.PE637       Location/Qualifiers
FT   CDS             814697..815623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0662"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00137"
FT                   /db_xref="GOA:D6ZTD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD1"
FT                   /protein_id="ADH00137.1"
FT                   /translation="MAMTSISESDAMALQVTDVTKHYDSGFTLDDVTFDLPKGYIMGLI
FT                   GPNGAGKSTLIKLILNMIHRDAGSIHVLGLDNIANEEPVKEQLGVVFDFSYMHEQWQVK
FT                   NIERIVAPLYPSWDGGCYHKYLDTFGLGDAQNGKKHIKDLSRGMQMKLMLAIALSHDAK
FT                   LLILDEPTSGLDVLARDELMDILHAYIEDGEHSVLFSTHITADLERAADFITYITDGRL
FT                   YYTGPKDEFEESFRLIKGGPDELAQLPADVVLGSHTYATGFDALVRSDRLDAVASVVSG
FT                   LVVESASIDDIIRLTNAHDSNRDLSGR"
     MAMTSISESD AMALQVTDVT KHYDSGFTLD DVTFDLPKGY IMGLIGPNGA GKSTLIKLIL        60
     NMIHRDAGSI HVLGLDNIAN EEPVKEQLGV VFDFSYMHEQ WQVKNIERIV APLYPSWDGG       120
     CYHKYLDTFG LGDAQNGKKH IKDLSRGMQM KLMLAIALSH DAKLLILDEP TSGLDVLARD       180
     ELMDILHAYI EDGEHSVLFS THITADLERA ADFITYITDG RLYYTGPKDE FEESFRLIKG       240
     GPDELAQLPA DVVLGSHTYA TGFDALVRSD RLDAVASVVS GLVVESASID DIIRLTNAHD       300
     SNRDLSGR                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page