(data stored in ACNUC30630 zone)

EMBL: CP002010.PE71

CP002010.PE71        Location/Qualifiers
FT   CDS             99503..100093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0073"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99569"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC4"
FT                   /protein_id="ADG99569.1"
FT                   /translation="MILRSRSMNNQDTTLQDPQAIHDPRRFCNIDPDAFDYAIGRVENV
FT                   GVDAADYCGEQEKQSVSEVRFGNGPTLGSDLSTQTSQRSLAMILVTTTPSVDGYTITNY
FT                   QGIVFGEVVSGVNMFKDLGAGLRNMFGGRSQGYEEELMRARNEAIAEMQQRAEAMGAHA
FT                   VVGVDIDYEVLGADNGMLMVTASGTAVQIARTA"
     MILRSRSMNN QDTTLQDPQA IHDPRRFCNI DPDAFDYAIG RVENVGVDAA DYCGEQEKQS        60
     VSEVRFGNGP TLGSDLSTQT SQRSLAMILV TTTPSVDGYT ITNYQGIVFG EVVSGVNMFK       120
     DLGAGLRNMF GGRSQGYEEE LMRARNEAIA EMQQRAEAMG AHAVVGVDID YEVLGADNGM       180
     LMVTASGTAV QIARTA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page