(data stored in ACNUC30630 zone)

EMBL: CP002010.PE93

CP002010.PE93        Location/Qualifiers
FT   CDS             129062..130147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0099"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99592"
FT                   /db_xref="GOA:D6ZXE6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE6"
FT                   /protein_id="ADG99592.1"
FT                   /translation="MVGMRDVAKKAGVSLSTVSLVVNGNGYVSDDMRERVRKAMQLLNY
FT                   VPNELARNLYHDRTNLVGVIVPTIRHPFFATFTAHLQHALAAQGLRTMLCSTADEAEGE
FT                   IQYVDMLRRHMMDGIVMCAHTSHPGDYWTSIHRPIVAFDRVLGDGISSIGSDHEQGGRL
FT                   IAQMLIRNGTKHVVMIGGPRDQFFDLAARGEVEEGPFDLGKTTFPTVRYYLTLEQELTS
FT                   AGVKYEYVEAGEVMDFAGYHRAVSNALDKVTTDGVDAVVSSDIGASFCVREALSRGISI
FT                   PDELQIVAYDGTYLTDLAGMKLTAVAQDFSAIAQSAADHIVQAIANEEVAAANASRKNI
FT                   PKPFEPNVLIPMTLVPGDTTH"
     MVGMRDVAKK AGVSLSTVSL VVNGNGYVSD DMRERVRKAM QLLNYVPNEL ARNLYHDRTN        60
     LVGVIVPTIR HPFFATFTAH LQHALAAQGL RTMLCSTADE AEGEIQYVDM LRRHMMDGIV       120
     MCAHTSHPGD YWTSIHRPIV AFDRVLGDGI SSIGSDHEQG GRLIAQMLIR NGTKHVVMIG       180
     GPRDQFFDLA ARGEVEEGPF DLGKTTFPTV RYYLTLEQEL TSAGVKYEYV EAGEVMDFAG       240
     YHRAVSNALD KVTTDGVDAV VSSDIGASFC VREALSRGIS IPDELQIVAY DGTYLTDLAG       300
     MKLTAVAQDF SAIAQSAADH IVQAIANEEV AAANASRKNI PKPFEPNVLI PMTLVPGDTT       360
     H                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page