(data stored in ACNUC30630 zone)

EMBL: CP002010.PHET

CP002010.PHET        Location/Qualifiers
FT   CDS             785210..787819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BLJ_0634"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00109"
FT                   /db_xref="GOA:D6ZTA3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA3"
FT                   /protein_id="ADH00109.1"
FT                   /translation="MPMIDIDWLKDHVEVPEGLTYEQLAKDLVKVGLEEEEIHSSQVTG
FT                   PIVVGYVVDATPEPQKNGKTINWCHVDCGDEWNETDEDGNKVPRGIICGAPNMKAGEKV
FT                   VVTLPGAVLPGDFKIEPRKTYGHISNGMCASERELGLGDNHNGIILLRQYGFSEAEYEA
FT                   LKPGQDAMHLLHLDQPLLEINITPDRGYTLSYRGVAREYHHSTGAAYTDPAVALNEKAP
FT                   EPADYQPGTPVDIDVEIDDNNPIHGVPGCDRYYARIVKDFNPNAHTPNWMRRRLIRAGM
FT                   RSISLAVDVTNYVMLDLGQPMHAYDLDKLEGPIVVRRANEGEKLTTLDGKEHDLSVEDL
FT                   LITDSPNGERGSRILGLAGVMGGLYGEVTADTKNILLEAAHFDQVTIARSARRHKIPSE
FT                   ASRRFERGVDTALQPAATQMAAELMAKYGNGEPSEHPNDVNNTPRAKVIHFKASEVARV
FT                   AGLDVDINRISDILTDIGCTVAGGGNGEFAVTAPSWRPDLNEPCDLVEEIARLVGYDQI
FT                   PITVPPAPVEGLVGLTPDQQRRRRVADELAEFGMVESLSYPFVGDDDYKAFGFDPEATK
FT                   KVSVEIANPLYGDRPYLRREILPTLATTVQRNIRRGIENVSLYELGHVYLWDPNAPAIP
FT                   ALPGGVRPTDEQLAALDAGLPEQPDHVAGILTGLAEDDGWMGGKRPVDWSDAVEAVRRI
FT                   AGRIGAAIELDQPAADDVPVQWHPGRVARVMVGDVFTGWVGELHPRVNEALGFPAHSAA
FT                   FELNLTALFATLTGKPVQAKPISTFPPVKQDLAFTVDETVTAGQLENVIRKAAGANLES
FT                   IELFDVFTGEQVGEGKKSLAYAVVFRSPSKTLSAEDSDAIRKAIVAEAAEIGAQLRA"
     MPMIDIDWLK DHVEVPEGLT YEQLAKDLVK VGLEEEEIHS SQVTGPIVVG YVVDATPEPQ        60
     KNGKTINWCH VDCGDEWNET DEDGNKVPRG IICGAPNMKA GEKVVVTLPG AVLPGDFKIE       120
     PRKTYGHISN GMCASERELG LGDNHNGIIL LRQYGFSEAE YEALKPGQDA MHLLHLDQPL       180
     LEINITPDRG YTLSYRGVAR EYHHSTGAAY TDPAVALNEK APEPADYQPG TPVDIDVEID       240
     DNNPIHGVPG CDRYYARIVK DFNPNAHTPN WMRRRLIRAG MRSISLAVDV TNYVMLDLGQ       300
     PMHAYDLDKL EGPIVVRRAN EGEKLTTLDG KEHDLSVEDL LITDSPNGER GSRILGLAGV       360
     MGGLYGEVTA DTKNILLEAA HFDQVTIARS ARRHKIPSEA SRRFERGVDT ALQPAATQMA       420
     AELMAKYGNG EPSEHPNDVN NTPRAKVIHF KASEVARVAG LDVDINRISD ILTDIGCTVA       480
     GGGNGEFAVT APSWRPDLNE PCDLVEEIAR LVGYDQIPIT VPPAPVEGLV GLTPDQQRRR       540
     RVADELAEFG MVESLSYPFV GDDDYKAFGF DPEATKKVSV EIANPLYGDR PYLRREILPT       600
     LATTVQRNIR RGIENVSLYE LGHVYLWDPN APAIPALPGG VRPTDEQLAA LDAGLPEQPD       660
     HVAGILTGLA EDDGWMGGKR PVDWSDAVEA VRRIAGRIGA AIELDQPAAD DVPVQWHPGR       720
     VARVMVGDVF TGWVGELHPR VNEALGFPAH SAAFELNLTA LFATLTGKPV QAKPISTFPP       780
     VKQDLAFTVD ETVTAGQLEN VIRKAAGANL ESIELFDVFT GEQVGEGKKS LAYAVVFRSP       840
     SKTLSAEDSD AIRKAIVAEA AEIGAQLRA                                         869
//

If you have problems or comments...

PBIL Back to PBIL home page