(data stored in ACNUC30630 zone)

EMBL: CP002010.PPNK

CP002010.PPNK        Location/Qualifiers
FT   CDS             810606..811634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="BLJ_0658"
FT                   /product="NAD(+) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00133"
FT                   /db_xref="GOA:D6ZTC7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC7"
FT                   /protein_id="ADH00133.1"
FT                   /translation="MAKRNAVVVTHTRLRQTGTVVAEAVSQLRVAGFEVTIIDNTEAPD
FT                   FGVQPPCVSDDTEIVVVLGGDGTILRAAELVHCTQVPILGVNMGHVGFLAEFESFQIDE
FT                   AIRRVATHDYSIDERMIAHVDVWLPGATKPIEDWALNDITLERADRGKMVELSIRVDDV
FT                   EMNSFGADGVIVSTPTGSTAYAFSAGGPVMWPNVKALQLIPLAAHALFARPLIIGSGST
FT                   FTIDILDESMSEGWICCDGRRQRALPQGTRVMVRESRDTLRLARLSGMPFTNRLVSKFD
FT                   LPVVGWREHARNEASSQPLHHGHTFPAAAYAAGVAVAVAGDAGVAGTDPDKPGERDGKA
FT                   GA"
     MAKRNAVVVT HTRLRQTGTV VAEAVSQLRV AGFEVTIIDN TEAPDFGVQP PCVSDDTEIV        60
     VVLGGDGTIL RAAELVHCTQ VPILGVNMGH VGFLAEFESF QIDEAIRRVA THDYSIDERM       120
     IAHVDVWLPG ATKPIEDWAL NDITLERADR GKMVELSIRV DDVEMNSFGA DGVIVSTPTG       180
     STAYAFSAGG PVMWPNVKAL QLIPLAAHAL FARPLIIGSG STFTIDILDE SMSEGWICCD       240
     GRRQRALPQG TRVMVRESRD TLRLARLSGM PFTNRLVSKF DLPVVGWREH ARNEASSQPL       300
     HHGHTFPAAA YAAGVAVAVA GDAGVAGTDP DKPGERDGKA GA                          342
//

If you have problems or comments...

PBIL Back to PBIL home page