(data stored in ACNUC30630 zone)

EMBL: CP002010.RPMF

CP002010.RPMF        Location/Qualifiers
FT   CDS             complement(456166..456360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="BLJ_0376"
FT                   /product="ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99858"
FT                   /db_xref="GOA:D6ZY62"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY62"
FT                   /protein_id="ADG99858.1"
FT                   /translation="MALPKYKTSRANTHSRRANWKATAAATVNCPNCGAPALPHMACPS
FT                   CGNYRGRTYRSAIQPAHTK"
     MALPKYKTSR ANTHSRRANW KATAAATVNC PNCGAPALPH MACPSCGNYR GRTYRSAIQP        60
     AHTK                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page