(data stored in ACNUC30630 zone)

EMBL: CP002010.RPSF

CP002010.RPSF        Location/Qualifiers
FT   CDS             304388..304678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BLJ_0233"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99721"
FT                   /db_xref="GOA:D6ZXS5"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS5"
FT                   /protein_id="ADG99721.1"
FT                   /translation="MSAHKYELMFIADPELDERGLKKLTEQYLELVTKEGGSFDEPDYW
FT                   GRRKLAYEIAGKTEGNYVVVKYTAEPATSDELDRVLNLNESVIRTKILRKG"
     MSAHKYELMF IADPELDERG LKKLTEQYLE LVTKEGGSFD EPDYWGRRKL AYEIAGKTEG        60
     NYVVVKYTAE PATSDELDRV LNLNESVIRT KILRKG                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page