(data stored in ACNUC1104 zone)

EMBL: CP002026.PE1

CP002026.PE1         Location/Qualifiers
FT   CDS             169..450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0001"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bvi:Bcep1808_0172 helix-turn-helix domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87338"
FT                   /db_xref="GOA:D6ZZS4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH87338.1"
FT                   /translation="MCWATLGAGVRVTRETRGHGVREAAAAAGVSAATVSRCENGRELS
FT                   FDSLARLSAYVGLHPHAYTVKPFPDPGSTGNTHCNSLKTQEAPHDRHG"
     MCWATLGAGV RVTRETRGHG VREAAAAAGV SAATVSRCEN GRELSFDSLA RLSAYVGLHP        60
     HAYTVKPFPD PGSTGNTHCN SLKTQEAPHD RHG                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page