(data stored in ACNUC1104 zone)

EMBL: CP002026.PE100

CP002026.PE100       Location/Qualifiers
FT   CDS             91184..92413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0100"
FT                   /product="protein of unknown function DUF1688"
FT                   /note="PFAM: protein of unknown function DUF1688; KEGG:
FT                   bja:blr7238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87437"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0S7"
FT                   /inference="protein motif:PFAM:PF07958"
FT                   /protein_id="ADH87437.1"
FT                   /translation="MTPPELVALRSPAAVRARCHQVLDYVRVGHSPHFTVDEAALDGVA
FT                   DYVAQVTRQAYPTLDIPYHSRWRHFDAGGVDRWAALEGRLEGADKAERARVMIDLAVVS
FT                   VLLDAGAGDAWRYREEATGLTVTRSEGLAVASLRMFEVGGFSSDPKVPLRADAKALIGL
FT                   DAATLAKQFQVSDDNPLVGVSGRVALINRLGNALAARPDLFGTEVPRPGGLYDALLPKA
FT                   KIGRLPAPAILGALLDGLSSIWPSGLDVEGVALGDVGRHPAVRVADLSDQLVPFHKLSQ
FT                   WLTYSLLEPFEAAGLAVTELDELTALPEYRNGGLLVDLEVIVPRQPIDPAQKHPVSSEL
FT                   VVEWRALTVALMDLLAGRVRERLGLDASQFPLAKLLQGGTWSAGRRIAAERRPPAGPPP
FT                   IAIDADGTVF"
     MTPPELVALR SPAAVRARCH QVLDYVRVGH SPHFTVDEAA LDGVADYVAQ VTRQAYPTLD        60
     IPYHSRWRHF DAGGVDRWAA LEGRLEGADK AERARVMIDL AVVSVLLDAG AGDAWRYREE       120
     ATGLTVTRSE GLAVASLRMF EVGGFSSDPK VPLRADAKAL IGLDAATLAK QFQVSDDNPL       180
     VGVSGRVALI NRLGNALAAR PDLFGTEVPR PGGLYDALLP KAKIGRLPAP AILGALLDGL       240
     SSIWPSGLDV EGVALGDVGR HPAVRVADLS DQLVPFHKLS QWLTYSLLEP FEAAGLAVTE       300
     LDELTALPEY RNGGLLVDLE VIVPRQPIDP AQKHPVSSEL VVEWRALTVA LMDLLAGRVR       360
     ERLGLDASQF PLAKLLQGGT WSAGRRIAAE RRPPAGPPPI AIDADGTVF                   409
//

If you have problems or comments...

PBIL Back to PBIL home page