(data stored in ACNUC1104 zone)

EMBL: CP002026.PE101

CP002026.PE101       Location/Qualifiers
FT   CDS             complement(92417..93379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ret:RHE_CH03508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87438"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0S8"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87438.1"
FT                   /translation="MHRVLFAAAAAVLLSLSSAGAQDFPNRPVTLDIPFPAGGSTDLVG
FT                   RLIGEGMSADLGQPVIIENRGGGGGSLGTAHLAKQPPDGYAVMMGTVSTHALNPALYRN
FT                   LPFDPVKSFAPVSLLVIVPNALVVHPSFPANTVEEFIALLKANPGKYSYASAGNGTPGH
FT                   LSGELFKTMAGVDMQHIPYQGAGPALVDVISGQVPIMFDNLPTASGYIKSGKLKTLGVT
FT                   TLKRAPSFPDLPAVAETLPGYETYSWNALFAPAGTPPAIVAKLNQAANKALATPKVQAR
FT                   LADFSAVSVGSTPQELEAHVKAELAKWAPIVKASGAQLD"
     MHRVLFAAAA AVLLSLSSAG AQDFPNRPVT LDIPFPAGGS TDLVGRLIGE GMSADLGQPV        60
     IIENRGGGGG SLGTAHLAKQ PPDGYAVMMG TVSTHALNPA LYRNLPFDPV KSFAPVSLLV       120
     IVPNALVVHP SFPANTVEEF IALLKANPGK YSYASAGNGT PGHLSGELFK TMAGVDMQHI       180
     PYQGAGPALV DVISGQVPIM FDNLPTASGY IKSGKLKTLG VTTLKRAPSF PDLPAVAETL       240
     PGYETYSWNA LFAPAGTPPA IVAKLNQAAN KALATPKVQA RLADFSAVSV GSTPQELEAH       300
     VKAELAKWAP IVKASGAQLD                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page