(data stored in ACNUC1104 zone)

EMBL: CP002026.PE104

CP002026.PE104       Location/Qualifiers
FT   CDS             96119..97426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0104"
FT                   /product="ABC transporter, binding protein"
FT                   /note="KEGG: rhi:NGR_b12830 ABC transporter, binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87441"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T1"
FT                   /inference="similar to AA sequence:KEGG:NGR_b12830"
FT                   /protein_id="ADH87441.1"
FT                   /translation="MSKNTSDRIGASGAKGISRRNVLKGAAAFSGVAAGSGAITGFPTI
FT                   WAQNPITLRQFGTGVSNLNAIAEKCKADLGITLQMTALDSDAVSQRVVTQANSFDIADI
FT                   EYWICKKVFAAGTLQPMDVKKIKYYDQIVPIFTTGKLTPESKIAQGTAPSTVGFVEGPD
FT                   SKKFAKEPTQWMTLIPTIYNADTLGIRPDLVGRPIKNWKDILDPAFKGKTSILNIPSIG
FT                   IMDAAMICESAGLIKYADKGNMTKKEIDFTIDFLIKTKKAGQFRAFWKTFDESVNLMAS
FT                   GEVVIQSMWSPAVAAVRSKGIPCVYQPLEEGYRAWGGGLGMAKHLKGAQLDAAYEYINW
FT                   YLSGWVGAYLNRQGYYSAVLSTAEKNMTPDEWAFWMLGQPAKADILSPEGKVMYTAGAV
FT                   RDGGSFEQRMGAVACWNSVMDEDRYMVRRWNEFIAA"
     MSKNTSDRIG ASGAKGISRR NVLKGAAAFS GVAAGSGAIT GFPTIWAQNP ITLRQFGTGV        60
     SNLNAIAEKC KADLGITLQM TALDSDAVSQ RVVTQANSFD IADIEYWICK KVFAAGTLQP       120
     MDVKKIKYYD QIVPIFTTGK LTPESKIAQG TAPSTVGFVE GPDSKKFAKE PTQWMTLIPT       180
     IYNADTLGIR PDLVGRPIKN WKDILDPAFK GKTSILNIPS IGIMDAAMIC ESAGLIKYAD       240
     KGNMTKKEID FTIDFLIKTK KAGQFRAFWK TFDESVNLMA SGEVVIQSMW SPAVAAVRSK       300
     GIPCVYQPLE EGYRAWGGGL GMAKHLKGAQ LDAAYEYINW YLSGWVGAYL NRQGYYSAVL       360
     STAEKNMTPD EWAFWMLGQP AKADILSPEG KVMYTAGAVR DGGSFEQRMG AVACWNSVMD       420
     EDRYMVRRWN EFIAA                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page