(data stored in ACNUC1104 zone)

EMBL: CP002026.PE105

CP002026.PE105       Location/Qualifiers
FT   CDS             97580..98431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0105"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avi:Avi_6277 ABC
FT                   transporter membrane spanning protein
FT                   (spermidine/putrescine)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87442"
FT                   /db_xref="GOA:D7A0T2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87442.1"
FT                   /translation="MTLSRIAPYLQAAPLTLILTAFLVLPIATIVMVSFWDYDSIQIFP
FT                   AFVFTNYEETITSPVTWNTYLNTLKYTGIVWAVTLFIGFWVAYYLAFHIRSATTQMVLF
FT                   LVCTIPFLTSNIIRMISWIPFLGRNGLLNQTLMTMGVIDQPLEFLLFSDFAVVLAMVHL
FT                   YTLFMVTPIFNTLMRIDRALIEAARDAGANALQILTNVIIPLAKPGIAIGSIFVVTLVM
FT                   GDFITVRFMSGGQSASVGLMMANQIALLQYPAAAANAVILLVLVLLLVGGILRIVNIRR
FT                   EL"
     MTLSRIAPYL QAAPLTLILT AFLVLPIATI VMVSFWDYDS IQIFPAFVFT NYEETITSPV        60
     TWNTYLNTLK YTGIVWAVTL FIGFWVAYYL AFHIRSATTQ MVLFLVCTIP FLTSNIIRMI       120
     SWIPFLGRNG LLNQTLMTMG VIDQPLEFLL FSDFAVVLAM VHLYTLFMVT PIFNTLMRID       180
     RALIEAARDA GANALQILTN VIIPLAKPGI AIGSIFVVTL VMGDFITVRF MSGGQSASVG       240
     LMMANQIALL QYPAAAANAV ILLVLVLLLV GGILRIVNIR REL                         283
//

If you have problems or comments...

PBIL Back to PBIL home page