(data stored in ACNUC1104 zone)

EMBL: CP002026.PE106

CP002026.PE106       Location/Qualifiers
FT   CDS             98435..99265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0106"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_3448 hypothetical
FT                   ABC transporter permease protein YdcV"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87443"
FT                   /db_xref="GOA:D7A0T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87443.1"
FT                   /translation="MNSEKRGPGFYVLTAFFVLFVLFLYGPLTTIFILSFQGPNGGLTF
FT                   PMNGVSLRWFNNLLFEQQAVGDFGGAFTRSLVLGIMTMLTTVVVSLLAGLAFRRRFLGS
FT                   GPLFYLTIASLIVPSILISLGIGLAFNVLGLETAWYSSAFGAHLTWTLPFGLLIMFAVF
FT                   NRFNPAYEEAARDLGASPWQTFAHVVLPIILPSLIGVGLFGFTLSYDEFARTLMTSGTF
FT                   NTLPLEIYGMTTNVTTPVLYALGTVTTVFSMGVIILALVTIAVLRKRRARRVAG"
     MNSEKRGPGF YVLTAFFVLF VLFLYGPLTT IFILSFQGPN GGLTFPMNGV SLRWFNNLLF        60
     EQQAVGDFGG AFTRSLVLGI MTMLTTVVVS LLAGLAFRRR FLGSGPLFYL TIASLIVPSI       120
     LISLGIGLAF NVLGLETAWY SSAFGAHLTW TLPFGLLIMF AVFNRFNPAY EEAARDLGAS       180
     PWQTFAHVVL PIILPSLIGV GLFGFTLSYD EFARTLMTSG TFNTLPLEIY GMTTNVTTPV       240
     LYALGTVTTV FSMGVIILAL VTIAVLRKRR ARRVAG                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page