(data stored in ACNUC1104 zone)

EMBL: CP002026.PE108

CP002026.PE108       Location/Qualifiers
FT   CDS             99700..100014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87445"
FT                   /db_xref="GOA:D7A0T5"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87445.1"
FT                   /translation="MRPTVSVPQNGGIRWLGMSTRDTPEARRKIVRLYLLLALPAFAFC
FT                   YVLAAIQGANGRLSALLGTIALAGCLVCAAAYHLLGPSSKQLLYVAAGVLALVTFFVAR
FT                   "
     MRPTVSVPQN GGIRWLGMST RDTPEARRKI VRLYLLLALP AFAFCYVLAA IQGANGRLSA        60
     LLGTIALAGC LVCAAAYHLL GPSSKQLLYV AAGVLALVTF FVAR                        104
//

If you have problems or comments...

PBIL Back to PBIL home page