(data stored in ACNUC1104 zone)

EMBL: CP002026.PE11

CP002026.PE11        Location/Qualifiers
FT   CDS             7443..7940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_1749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87348"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT4"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_1749"
FT                   /protein_id="ADH87348.1"
FT                   /translation="MSDEKSEAPGEVDLFGMPVRPIRDRRGRPCFKKDKENQDFVAVRI
FT                   AAGWSQARIAEDMGIDEKTLRKHFSRELENGRVFVEGLVLDVLLKQTREGKSPAIRQLR
FT                   EMLEAAGPQAPRGRSKPKSDEEEEDEDGKAAPVGKKEQQMQDAQVVPPEYGDIFDRIDR
FT                   RH"
     MSDEKSEAPG EVDLFGMPVR PIRDRRGRPC FKKDKENQDF VAVRIAAGWS QARIAEDMGI        60
     DEKTLRKHFS RELENGRVFV EGLVLDVLLK QTREGKSPAI RQLREMLEAA GPQAPRGRSK       120
     PKSDEEEEDE DGKAAPVGKK EQQMQDAQVV PPEYGDIFDR IDRRH                       165
//

If you have problems or comments...

PBIL Back to PBIL home page