(data stored in ACNUC1104 zone)

EMBL: CP002026.PE112

CP002026.PE112       Location/Qualifiers
FT   CDS             complement(106198..107730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0112"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bid:Bind_3073 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87449"
FT                   /db_xref="GOA:D7A0T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0T9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87449.1"
FT                   /translation="MSALLEMRGISKHFTGVKALNDVSFEVEPGEIHALVGENGAGKST
FT                   LMKVLSGVYPHGSYDGSIMFDGEERRFRDIIDSEALGIIIIHQELALIPLMSIAENIFI
FT                   ANPPARFGVIDRGAVHRRTRELLAKVGLNEEPDTLVTDIGVGKQQLVEIAKALSKKVRL
FT                   LILDEPTASLSEKDSAALLDLLREFRAQGISSILISHKLNEVSKVADRITVLRDGRTVD
FT                   TMDCHEGAVEEDRIIRKMVDRDLEHRFPKREPKIGETIFRVADWSVHHPLHADRQVIKD
FT                   VDFEVRRGEIVGIAGLMGAGRTEFAMSIFGRSWGQKIGGRAEIEGREADLSTVRRAIDA
FT                   GLAYVTEDRKELGLLLNEDVRKNVTLANLAAVSSAQVIDDVRELAVASDYRGRMRIRSH
FT                   SVYQEAGKLSGGNQQKVVLSKWLFTDPKVLILDEPTRGIDVGAKYEIYCIINELADAGK
FT                   GVVVISSEMPELLGICDRICVMNEGAFVGEFPAAEATQEKIMRAIMRKGDRS"
     MSALLEMRGI SKHFTGVKAL NDVSFEVEPG EIHALVGENG AGKSTLMKVL SGVYPHGSYD        60
     GSIMFDGEER RFRDIIDSEA LGIIIIHQEL ALIPLMSIAE NIFIANPPAR FGVIDRGAVH       120
     RRTRELLAKV GLNEEPDTLV TDIGVGKQQL VEIAKALSKK VRLLILDEPT ASLSEKDSAA       180
     LLDLLREFRA QGISSILISH KLNEVSKVAD RITVLRDGRT VDTMDCHEGA VEEDRIIRKM       240
     VDRDLEHRFP KREPKIGETI FRVADWSVHH PLHADRQVIK DVDFEVRRGE IVGIAGLMGA       300
     GRTEFAMSIF GRSWGQKIGG RAEIEGREAD LSTVRRAIDA GLAYVTEDRK ELGLLLNEDV       360
     RKNVTLANLA AVSSAQVIDD VRELAVASDY RGRMRIRSHS VYQEAGKLSG GNQQKVVLSK       420
     WLFTDPKVLI LDEPTRGIDV GAKYEIYCII NELADAGKGV VVISSEMPEL LGICDRICVM       480
     NEGAFVGEFP AAEATQEKIM RAIMRKGDRS                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page