(data stored in ACNUC1104 zone)

EMBL: CP002026.PE113

CP002026.PE113       Location/Qualifiers
FT   CDS             complement(107802..108872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0113"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bid:Bind_3074 multiple
FT                   sugar-binding periplasmic receptor ChvE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87450"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U0"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADH87450.1"
FT                   /translation="MKRLTTTLSAFALGALALSFAVPASAQDKGTVGIAMPTKSSARWI
FT                   ADGDNMVKVLKERGYDTDLQYAEDDIPNQLSQIENMVTKGAKVLVIASIDGTTLSDVLK
FT                   QAQAQGIKVIAYDRLIRDTPNVDYYATFDNFQVGVLQAQSLLKGLGYPENKGPFNIELF
FT                   GGSPDDNNAYFFYDGAMSVLKPLIDNGTLKVASGQMGMDKVSTLRWDGATAQARMDNLL
FT                   SAYYNDKRIDGVLSPYDGLSIGILSSLKGVGYGSGGMKMPVVTGQDAEVPSMKSILAGE
FT                   QYSTIFKDTRDLAKVTADMVDASLSGKEVTVNDTKTYNNGVKVVPSYLLKPVVVDKGNW
FT                   EKVLVGSGYYKADQIN"
     MKRLTTTLSA FALGALALSF AVPASAQDKG TVGIAMPTKS SARWIADGDN MVKVLKERGY        60
     DTDLQYAEDD IPNQLSQIEN MVTKGAKVLV IASIDGTTLS DVLKQAQAQG IKVIAYDRLI       120
     RDTPNVDYYA TFDNFQVGVL QAQSLLKGLG YPENKGPFNI ELFGGSPDDN NAYFFYDGAM       180
     SVLKPLIDNG TLKVASGQMG MDKVSTLRWD GATAQARMDN LLSAYYNDKR IDGVLSPYDG       240
     LSIGILSSLK GVGYGSGGMK MPVVTGQDAE VPSMKSILAG EQYSTIFKDT RDLAKVTADM       300
     VDASLSGKEV TVNDTKTYNN GVKVVPSYLL KPVVVDKGNW EKVLVGSGYY KADQIN           356
//

If you have problems or comments...

PBIL Back to PBIL home page