(data stored in ACNUC1104 zone)

EMBL: CP002026.PE116

CP002026.PE116       Location/Qualifiers
FT   CDS             complement(111706..112791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0116"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="KEGG: bid:Bind_3076 aldose 1-epimerase; PFAM: Aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87453"
FT                   /db_xref="GOA:D7A0U3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U3"
FT                   /inference="protein motif:PRIAM:5.1.3.3"
FT                   /protein_id="ADH87453.1"
FT                   /translation="MHAAAHASPLLREPFGTLSDGRAVERIRLAGEGGFEVAIITHGAA
FT                   VQALHVPDRDGRLADIVLGHDDLAPYEAHRRYFGAAVGRYANRIAGGRFPLDGTTCQVP
FT                   ANNGANALHGGPDGFDRRLWSVEALADGSVPSVTLGLTSPDGDQGFPGELDVRVTYALT
FT                   GPRELSIAFEATTSRPTIVNLTHHGFFNLAGVEAGGDVLGHELTLHADAYLPIDAAAIP
FT                   VGGPTPVAGTPFDFRIPRLIGGRIREAHEQLRLGRGYDHNFCVAGGRTAEPRLAARVEH
FT                   PASGRVLELLTDQPGLQFYSGNFLDGTTEGKFRRLHRQSDAFCLEPQAWPDTPNRPNFP
FT                   SARLDPGETYRHVSLYRFSTV"
     MHAAAHASPL LREPFGTLSD GRAVERIRLA GEGGFEVAII THGAAVQALH VPDRDGRLAD        60
     IVLGHDDLAP YEAHRRYFGA AVGRYANRIA GGRFPLDGTT CQVPANNGAN ALHGGPDGFD       120
     RRLWSVEALA DGSVPSVTLG LTSPDGDQGF PGELDVRVTY ALTGPRELSI AFEATTSRPT       180
     IVNLTHHGFF NLAGVEAGGD VLGHELTLHA DAYLPIDAAA IPVGGPTPVA GTPFDFRIPR       240
     LIGGRIREAH EQLRLGRGYD HNFCVAGGRT AEPRLAARVE HPASGRVLEL LTDQPGLQFY       300
     SGNFLDGTTE GKFRRLHRQS DAFCLEPQAW PDTPNRPNFP SARLDPGETY RHVSLYRFST       360
     V                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page