(data stored in ACNUC1104 zone)

EMBL: CP002026.PE118

CP002026.PE118       Location/Qualifiers
FT   CDS             complement(113723..114655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0118"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   xau:Xaut_1021 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87455"
FT                   /db_xref="GOA:D7A0U5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U5"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ADH87455.1"
FT                   /translation="MTTSSAAGPYKGVFPVAPTVFDADGRLDLDGQKRAIDFMIDAGSH
FT                   GLCILANFSEQFVLTDEERDLVMETVLEHVGGRVPVIVTTTHFATHVCAERSRRAQEMG
FT                   AAMVMIMPPYHGATFRVPEGAIYDFYRAVCDAIDIPIMVQDAPIAGTPLSVPFLARMAK
FT                   EIEHLAYFKIEVPQAAAKLRALIEAGGDAIVGPWDGEEAITLMADLDAGATGAMTGGGY
FT                   PDGIRQIIDPYVAGDREAAVDAYMRWLPLINYENRQCGLAACKALMQEGGVIAHETLRA
FT                   PLPTLHPATRAGLIEIARRLDPLVLSWGR"
     MTTSSAAGPY KGVFPVAPTV FDADGRLDLD GQKRAIDFMI DAGSHGLCIL ANFSEQFVLT        60
     DEERDLVMET VLEHVGGRVP VIVTTTHFAT HVCAERSRRA QEMGAAMVMI MPPYHGATFR       120
     VPEGAIYDFY RAVCDAIDIP IMVQDAPIAG TPLSVPFLAR MAKEIEHLAY FKIEVPQAAA       180
     KLRALIEAGG DAIVGPWDGE EAITLMADLD AGATGAMTGG GYPDGIRQII DPYVAGDREA       240
     AVDAYMRWLP LINYENRQCG LAACKALMQE GGVIAHETLR APLPTLHPAT RAGLIEIARR       300
     LDPLVLSWGR                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page