(data stored in ACNUC1104 zone)

EMBL: CP002026.PE119

CP002026.PE119       Location/Qualifiers
FT   CDS             complement(114665..116425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0119"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: xau:Xaut_1022 dihydroxy-acid dehydratase;
FT                   PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87456"
FT                   /db_xref="GOA:D7A0U6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U6"
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /protein_id="ADH87456.1"
FT                   /translation="MSDDSDHGSKKPGSGRPLRSQAWFGRQDKMGFYYRSFLKNSGQPQ
FT                   DRFDGRPVIGICNTWSELTPCNGHFRDLAEHVRYGVLDAGGYPLEFPVSSLGEVTMRPT
FT                   AMLFRNLASMDVEEAIRAHPLDGVVLLMGCDKTTPALLMGAASADLPAIGVSGGPQLRG
FT                   VYRGQIIGSGTNIISMSEQLRAGEITLAEFHEAEAAMNRSAGSCMTMGTASTMASMVEA
FT                   LGIGLPENAAIPAADARRNLLARMAGRRIVEMVKEDLKPSDILTREAFENAIRTLAAIG
FT                   GSTNAVVHLLAIAGRVGVELTLADFDRLGRNIHCLVDLMPSGRFLMEDFYYAGGLPAVL
FT                   RALGERGLLHKDALTVNGSSIWENVAAAQCWNAEVITPFDAPFKAEAGIAILTGNLAPN
FT                   GAVIKPSAASPELMQHTGRAVVFESVEEMHHAVNDEALDIDADCIMVLKNCGPKGYPGM
FT                   AEVGNMPLPAKLLRAGVRDMIRISDARMSGTAYGTVVLHVAPEATAGGPLALVQNGDLI
FT                   TLDVPARSLHLHVDEAELAARRAAWVAPEPHAARGYQRLYVNHVLQADRGADFDFLVGR
FT                   SGSPVARDNH"
     MSDDSDHGSK KPGSGRPLRS QAWFGRQDKM GFYYRSFLKN SGQPQDRFDG RPVIGICNTW        60
     SELTPCNGHF RDLAEHVRYG VLDAGGYPLE FPVSSLGEVT MRPTAMLFRN LASMDVEEAI       120
     RAHPLDGVVL LMGCDKTTPA LLMGAASADL PAIGVSGGPQ LRGVYRGQII GSGTNIISMS       180
     EQLRAGEITL AEFHEAEAAM NRSAGSCMTM GTASTMASMV EALGIGLPEN AAIPAADARR       240
     NLLARMAGRR IVEMVKEDLK PSDILTREAF ENAIRTLAAI GGSTNAVVHL LAIAGRVGVE       300
     LTLADFDRLG RNIHCLVDLM PSGRFLMEDF YYAGGLPAVL RALGERGLLH KDALTVNGSS       360
     IWENVAAAQC WNAEVITPFD APFKAEAGIA ILTGNLAPNG AVIKPSAASP ELMQHTGRAV       420
     VFESVEEMHH AVNDEALDID ADCIMVLKNC GPKGYPGMAE VGNMPLPAKL LRAGVRDMIR       480
     ISDARMSGTA YGTVVLHVAP EATAGGPLAL VQNGDLITLD VPARSLHLHV DEAELAARRA       540
     AWVAPEPHAA RGYQRLYVNH VLQADRGADF DFLVGRSGSP VARDNH                      586
//

If you have problems or comments...

PBIL Back to PBIL home page