(data stored in ACNUC1104 zone)

EMBL: CP002026.PE12

CP002026.PE12        Location/Qualifiers
FT   CDS             7940..9658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0012"
FT                   /product="Terminase"
FT                   /note="PFAM: Terminase; KEGG: rsq:Rsph17025_1750 phage
FT                   terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87349"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZT5"
FT                   /inference="protein motif:PFAM:PF03354"
FT                   /protein_id="ADH87349.1"
FT                   /translation="MLPVLFACPDWFEKLQAGATPIPDLPIDPVLAECAVELFNKLRVP
FT                   DVPGMPTMAEAAGEWMRDIVRVAFGSVDRETGQRFVGEIFNLVPKKNGKTTNAATLGLI
FT                   WLMMNRRPNVDGIIVGPTQEVAEKCFEQASLMIAADEYLARRFKVIDHKKTIIDRHIDR
FT                   DTGIRRNAKLKIKSFDPKVVTGSIPAFAILDELHVMAHANFASRVVGQIRGGMITNPES
FT                   LLIIITTQSEVPPFGIFKQELDYARKVRDGEVTEDVRMLPILYEFPEAMQLATDKPWLD
FT                   PKNWPLVLPNLGRSLTIDRLQKEWRTAQQKGEGAAREWASQHLNVQIGTAMHGDRWVGV
FT                   DYWDAAADDRITLDYIKENSDVVVTGGDVGGLDDLWGLAVLGRHKETRHWMLWAKAWAQ
FT                   RIVLERHKEVAERLRDFEREGSLVICDRVTQDAEEAAAIIVSLRDAGLLPETGGVGLDP
FT                   AGVTALLEELALYEVGSPCVAAVSQGYRLSAAIFGTERKLADGTMKHCGSLLLNWCAGN
FT                   LMAEMRGSNVYMQKRTASAKIDPMMAAFNAVEMMSRNPVAANGPSVYEGRGILMV"
     MLPVLFACPD WFEKLQAGAT PIPDLPIDPV LAECAVELFN KLRVPDVPGM PTMAEAAGEW        60
     MRDIVRVAFG SVDRETGQRF VGEIFNLVPK KNGKTTNAAT LGLIWLMMNR RPNVDGIIVG       120
     PTQEVAEKCF EQASLMIAAD EYLARRFKVI DHKKTIIDRH IDRDTGIRRN AKLKIKSFDP       180
     KVVTGSIPAF AILDELHVMA HANFASRVVG QIRGGMITNP ESLLIIITTQ SEVPPFGIFK       240
     QELDYARKVR DGEVTEDVRM LPILYEFPEA MQLATDKPWL DPKNWPLVLP NLGRSLTIDR       300
     LQKEWRTAQQ KGEGAAREWA SQHLNVQIGT AMHGDRWVGV DYWDAAADDR ITLDYIKENS       360
     DVVVTGGDVG GLDDLWGLAV LGRHKETRHW MLWAKAWAQR IVLERHKEVA ERLRDFEREG       420
     SLVICDRVTQ DAEEAAAIIV SLRDAGLLPE TGGVGLDPAG VTALLEELAL YEVGSPCVAA       480
     VSQGYRLSAA IFGTERKLAD GTMKHCGSLL LNWCAGNLMA EMRGSNVYMQ KRTASAKIDP       540
     MMAAFNAVEM MSRNPVAANG PSVYEGRGIL MV                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page