(data stored in ACNUC1104 zone)

EMBL: CP002026.PE120

CP002026.PE120       Location/Qualifiers
FT   CDS             complement(116437..117159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0120"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: bra:BRADO1811 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87457"
FT                   /db_xref="GOA:D7A0U7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U7"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87457.1"
FT                   /translation="MTSQIIVIPARRAHSNHAEVARTIGIDIIAGRYGEGAKLPGDAEL
FT                   TLIFGVSRPVLRESVKTLVAKGLLSTKARVGTVVRERAAWNMFDPDVLAWHLDAGINKQ
FT                   FLRDLAEIRLAVEPRAAALAAERRTENDLEVMRRAVARMADEPGASSGFAEADLALHVA
FT                   VAAASGNPFMRSIGAVIEAALRASFVLSAPVDAREHGIAVAAHERIVETIADKDAEAAA
FT                   AAMTNVIFNGLRRQGATG"
     MTSQIIVIPA RRAHSNHAEV ARTIGIDIIA GRYGEGAKLP GDAELTLIFG VSRPVLRESV        60
     KTLVAKGLLS TKARVGTVVR ERAAWNMFDP DVLAWHLDAG INKQFLRDLA EIRLAVEPRA       120
     AALAAERRTE NDLEVMRRAV ARMADEPGAS SGFAEADLAL HVAVAAASGN PFMRSIGAVI       180
     EAALRASFVL SAPVDAREHG IAVAAHERIV ETIADKDAEA AAAAMTNVIF NGLRRQGATG       240
//

If you have problems or comments...

PBIL Back to PBIL home page