(data stored in ACNUC1104 zone)

EMBL: CP002026.PE121

CP002026.PE121       Location/Qualifiers
FT   CDS             complement(117156..118151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0121"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bbt:BBta_2130 inner membrane ABC transporter permease
FT                   protein YjfF"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87458"
FT                   /db_xref="GOA:D7A0U8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0U8"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH87458.1"
FT                   /translation="MTRSLNRLMPVFATTAVFLAGFLICSLAYPNFASLRVVMNLLTDN
FT                   AFLGIVAVGMTFVIISGGIDLSVGSVIGFTTVFLALAIERWGVPPFAAFVVILLLCAAF
FT                   GAAMGATIQYFELPPFIVTLAGMFLARGLSFLMSTDSIPITADLYANLSDHAIRLAGGA
FT                   RLTVPAMIMLAIVAAGMALLHLTRFGANVYALGGSRAATGLMGINVARTTVLIYTLSSV
FT                   LAGLSGIVFSLYTSSGYSLSAVGVELDAIAAVVIGGTLLSGGYGFVFGSFLGVLIQGLI
FT                   QTYISFDGSLSSWWAKIATGLLLFAFIAFQQITLHMARRSRLRPAGVAKP"
     MTRSLNRLMP VFATTAVFLA GFLICSLAYP NFASLRVVMN LLTDNAFLGI VAVGMTFVII        60
     SGGIDLSVGS VIGFTTVFLA LAIERWGVPP FAAFVVILLL CAAFGAAMGA TIQYFELPPF       120
     IVTLAGMFLA RGLSFLMSTD SIPITADLYA NLSDHAIRLA GGARLTVPAM IMLAIVAAGM       180
     ALLHLTRFGA NVYALGGSRA ATGLMGINVA RTTVLIYTLS SVLAGLSGIV FSLYTSSGYS       240
     LSAVGVELDA IAAVVIGGTL LSGGYGFVFG SFLGVLIQGL IQTYISFDGS LSSWWAKIAT       300
     GLLLFAFIAF QQITLHMARR SRLRPAGVAK P                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page